prot_M-pyrifera_M_contig94809.21872.1 (polypeptide) Macrocystis pyrifera P11B4 male
Overview
Homology
BLAST of mRNA_M-pyrifera_M_contig94809.21872.1 vs. uniprot
Match: UPI000F8EA85E (cytotoxic translational repressor of toxin-antitoxin stability system n=1 Tax=Legionella septentrionalis TaxID=2498109 RepID=UPI000F8EA85E) HSP 1 Score: 58.2 bits (139), Expect = 7.820e-10 Identity = 25/46 (54.35%), Postives = 32/46 (69.57%), Query Frame = 0 Query: 1 MKWNIEFTGKAAKQINKLPKSVQSILRLLVQDLSYMGTCPGKGWIN 46 M W I+ T KAAKQ+NKLPKSV++ L LL++D+ G G GW N Sbjct: 1 MNWTIKITSKAAKQVNKLPKSVKATLLLLLRDIERNGPATGSGWKN 46
BLAST of mRNA_M-pyrifera_M_contig94809.21872.1 vs. uniprot
Match: A0A078KWD1_9GAMM (Uncharacterized protein n=8 Tax=Legionella TaxID=445 RepID=A0A078KWD1_9GAMM) HSP 1 Score: 51.2 bits (121), Expect = 4.740e-7 Identity = 22/46 (47.83%), Postives = 30/46 (65.22%), Query Frame = 0 Query: 1 MKWNIEFTGKAAKQINKLPKSVQSILRLLVQDLSYMGTCPGKGWIN 46 M W I+ T KAAKQ++KLPKS ++ L LL++D+ G GW N Sbjct: 7 MNWTIKITNKAAKQVDKLPKSAKTTLLLLLRDIERNGPSTSGGWKN 52
BLAST of mRNA_M-pyrifera_M_contig94809.21872.1 vs. uniprot
Match: A0A849HZI5_9GAMM (Uncharacterized protein n=1 Tax=Legionellales bacterium TaxID=2026754 RepID=A0A849HZI5_9GAMM) HSP 1 Score: 48.5 bits (114), Expect = 3.510e-6 Identity = 22/37 (59.46%), Postives = 27/37 (72.97%), Query Frame = 0 Query: 1 MKWNIEFTGKAAKQINKLPKSVQSILRLLVQDLSYMG 37 MKWN+EFT KAAKQ+ L K Q+ LRLLV+D+ G Sbjct: 1 MKWNVEFTKKAAKQVAVLSKRTQAALRLLVEDIQENG 37 The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig94809.21872.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 of Macrocystis pyrifera male vs UniRef90) Total hits: 3
InterPro
Analysis Name: InterProScan on OGS1.0 of Macrocystis pyrifera male
Date Performed: 2022-09-29
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_M-pyrifera_M_contig94809.21872.1 ID=prot_M-pyrifera_M_contig94809.21872.1|Name=mRNA_M-pyrifera_M_contig94809.21872.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=47bpback to top Annotated Terms
The following terms have been associated with this polypeptide:
|