prot_M-pyrifera_M_contig93484.21589.1 (polypeptide) Macrocystis pyrifera P11B4 male
Overview
Homology
BLAST of mRNA_M-pyrifera_M_contig93484.21589.1 vs. uniprot
Match: UPI001685492F (DUF3223 domain-containing protein n=1 Tax=Anabaena catenula TaxID=1296320 RepID=UPI001685492F) HSP 1 Score: 93.6 bits (231), Expect = 7.400e-22 Identity = 42/70 (60.00%), Postives = 54/70 (77.14%), Query Frame = 0 Query: 1 LLYAFTLDFEIDPFKVSVESHNGTVAVFEDAMLTANWVGYHSANAELRLLSRTGHAQVSVERIDWSALLR 70 LL+ FTL I+P V+V S NGTV +FED L +WVGYH+ NAELRL+SRTGH+Q+S ER+DWS +L+ Sbjct: 162 LLFDFTLKSSINPLMVAVGSRNGTVPIFEDRQLNDDWVGYHNENAELRLVSRTGHSQLSTERVDWSIILQ 231 The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig93484.21589.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 of Macrocystis pyrifera male vs UniRef90) Total hits: 1
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_M-pyrifera_M_contig93484.21589.1 ID=prot_M-pyrifera_M_contig93484.21589.1|Name=mRNA_M-pyrifera_M_contig93484.21589.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=74bpback to top |