prot_M-pyrifera_M_contig9345.21578.1 (polypeptide) Macrocystis pyrifera P11B4 male
Overview
Homology
BLAST of mRNA_M-pyrifera_M_contig9345.21578.1 vs. uniprot
Match: D7G781_ECTSI (PAP_fibrillin domain-containing protein n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D7G781_ECTSI) HSP 1 Score: 87.0 bits (214), Expect = 3.610e-19 Identity = 38/49 (77.55%), Postives = 47/49 (95.92%), Query Frame = 0 Query: 2 QAIPERPNFVRASFGPPLLNLLGRRGLTVRAGPKSSVALAATYVDERVR 50 +AIP++PNFV+ASFGPPL+N LG+RGLT+R+GPKSSV LAATYVDER+R Sbjct: 190 KAIPDKPNFVKASFGPPLINFLGKRGLTIRSGPKSSVRLAATYVDERIR 238
BLAST of mRNA_M-pyrifera_M_contig9345.21578.1 vs. uniprot
Match: A0A6H5JIG4_9PHAE (PAP_fibrillin domain-containing protein (Fragment) n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5JIG4_9PHAE) HSP 1 Score: 82.8 bits (203), Expect = 5.400e-18 Identity = 37/49 (75.51%), Postives = 45/49 (91.84%), Query Frame = 0 Query: 2 QAIPERPNFVRASFGPPLLNLLGRRGLTVRAGPKSSVALAATYVDERVR 50 +AIP++PNFV+ASFGPPL+N LG+ GLT+R+GPKSSV LAATYVDER R Sbjct: 192 KAIPDKPNFVKASFGPPLINFLGKHGLTIRSGPKSSVRLAATYVDERDR 240 The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig9345.21578.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 of Macrocystis pyrifera male vs UniRef90) Total hits: 2
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_M-pyrifera_M_contig9345.21578.1 ID=prot_M-pyrifera_M_contig9345.21578.1|Name=mRNA_M-pyrifera_M_contig9345.21578.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=50bpback to top |