prot_M-pyrifera_M_contig93405.21568.1 (polypeptide) Macrocystis pyrifera P11B4 male
Overview
Homology
BLAST of mRNA_M-pyrifera_M_contig93405.21568.1 vs. uniprot
Match: A0A7X7F1B7_9BACT (ABC transporter permease subunit n=1 Tax=Pirellulaceae bacterium TaxID=2699754 RepID=A0A7X7F1B7_9BACT) HSP 1 Score: 50.1 bits (118), Expect = 7.070e-5 Identity = 29/94 (30.85%), Postives = 54/94 (57.45%), Query Frame = 0 Query: 4 LLWKDWRLSRTVLLAGIITLVLPYAIPVWVQWRGEGALEA-FAVATTQTLWLSCIVFAIWGGYIVSAERASQTDRFLQSLPIRNTSITGSRLLL 96 L+WK++RL+R +L AG+ L+LP+AI + R G F + + +++ ++ A+ GG ++ ER ++ FL +LP+ S+L+L Sbjct: 4 LIWKEYRLNRLILGAGLFLLLLPHAIALVNGLRHLGNWSHYFEQSMMFSFYVTHVILALLGGNSIAGERGDRSAEFLATLPLSRRRNLASKLVL 97 The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig93405.21568.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 of Macrocystis pyrifera male vs UniRef90) Total hits: 1
InterPro
Analysis Name: InterProScan on OGS1.0 of Macrocystis pyrifera male
Date Performed: 2022-09-29
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_M-pyrifera_M_contig93405.21568.1 ID=prot_M-pyrifera_M_contig93405.21568.1|Name=mRNA_M-pyrifera_M_contig93405.21568.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=109bpback to top |