mRNA_M-pyrifera_M_contig93405.21568.1 (mRNA) Macrocystis pyrifera P11B4 male
Overview
Homology
BLAST of mRNA_M-pyrifera_M_contig93405.21568.1 vs. uniprot
Match: A0A7X7F1B7_9BACT (ABC transporter permease subunit n=1 Tax=Pirellulaceae bacterium TaxID=2699754 RepID=A0A7X7F1B7_9BACT) HSP 1 Score: 50.1 bits (118), Expect = 7.070e-5 Identity = 29/94 (30.85%), Postives = 54/94 (57.45%), Query Frame = 1 Query: 10 LLWKDWRLSRTVLLAGIITLVLPYAIPVWVQWRGEGALEA-FAVATTQTLWLSCIVFAIWGGYIVSAERASQTDRFLQSLPIRNTSITGSRLLL 288 L+WK++RL+R +L AG+ L+LP+AI + R G F + + +++ ++ A+ GG ++ ER ++ FL +LP+ S+L+L Sbjct: 4 LIWKEYRLNRLILGAGLFLLLLPHAIALVNGLRHLGNWSHYFEQSMMFSFYVTHVILALLGGNSIAGERGDRSAEFLATLPLSRRRNLASKLVL 97 The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig93405.21568.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 of Macrocystis pyrifera male vs UniRef90) Total hits: 1
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_M-pyrifera_M_contig93405.21568.1 >prot_M-pyrifera_M_contig93405.21568.1 ID=prot_M-pyrifera_M_contig93405.21568.1|Name=mRNA_M-pyrifera_M_contig93405.21568.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=109bp LRALLWKDWRLSRTVLLAGIITLVLPYAIPVWVQWRGEGALEAFAVATTQback to top mRNA from alignment at M-pyrifera_M_contig93405:170..496- Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_M-pyrifera_M_contig93405.21568.1 ID=mRNA_M-pyrifera_M_contig93405.21568.1|Name=mRNA_M-pyrifera_M_contig93405.21568.1|organism=Macrocystis pyrifera P11B4 male|type=mRNA|length=327bp|location=Sequence derived from alignment at M-pyrifera_M_contig93405:170..496- (Macrocystis pyrifera P11B4 male)back to top Coding sequence (CDS) from alignment at M-pyrifera_M_contig93405:170..496- >mRNA_M-pyrifera_M_contig93405.21568.1 ID=mRNA_M-pyrifera_M_contig93405.21568.1|Name=mRNA_M-pyrifera_M_contig93405.21568.1|organism=Macrocystis pyrifera P11B4 male|type=CDS|length=654bp|location=Sequence derived from alignment at M-pyrifera_M_contig93405:170..496- (Macrocystis pyrifera P11B4 male)back to top |