prot_M-pyrifera_M_contig93377.21557.1 (polypeptide) Macrocystis pyrifera P11B4 male
Overview
Homology
BLAST of mRNA_M-pyrifera_M_contig93377.21557.1 vs. uniprot
Match: A0A7S0LW48_9CRYP (Hypothetical protein (Fragment) n=1 Tax=Cryptomonas curvata TaxID=233186 RepID=A0A7S0LW48_9CRYP) HSP 1 Score: 52.8 bits (125), Expect = 7.760e-6 Identity = 40/100 (40.00%), Postives = 56/100 (56.00%), Query Frame = 0 Query: 8 LERNNVAVVRCMGEADFQLSADGADPAIGAYAVLSNDSDFFLSPGIRYIPYETVVTKLEMKR---IYCSVFDRDLVMKELGLTSAEGLFLFSALAGNDYT 104 L + +V ++ C EAD +L + A GAYA+L NDSDF+L G R+IP E LE+ + VF +LV + L L+S + L +AL GND T Sbjct: 162 LRKMDVRILTCEEEADNELVRNLACIP-GAYAILGNDSDFYLMRGARFIPLE----HLEVTGAGPVCARVFSPELVAESLCLSS-DRLHELAALCGNDIT 255 The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig93377.21557.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 of Macrocystis pyrifera male vs UniRef90) Total hits: 1
InterPro
Analysis Name: InterProScan on OGS1.0 of Macrocystis pyrifera male
Date Performed: 2022-09-29
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_M-pyrifera_M_contig93377.21557.1 ID=prot_M-pyrifera_M_contig93377.21557.1|Name=mRNA_M-pyrifera_M_contig93377.21557.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=104bpback to top |