mRNA_M-pyrifera_M_contig93377.21557.1 (mRNA) Macrocystis pyrifera P11B4 male
Overview
Homology
BLAST of mRNA_M-pyrifera_M_contig93377.21557.1 vs. uniprot
Match: A0A7S0LW48_9CRYP (Hypothetical protein (Fragment) n=1 Tax=Cryptomonas curvata TaxID=233186 RepID=A0A7S0LW48_9CRYP) HSP 1 Score: 54.3 bits (129), Expect = 2.640e-6 Identity = 43/112 (38.39%), Postives = 59/112 (52.68%), Query Frame = 1 Query: 4 LPSNLMWHAQTVLERNNVAVVRCMGEADFQLSADGADPAIGAYAVLSNDSDFFLSPGIRYIPYETVVTKLEMKR---IYCSVFDRDLVMKELGLTSAEGLFLFSALAGNDYT 330 LP A L + +V ++ C EAD +L + A GAYA+L NDSDF+L G R+IP E LE+ + VF +LV + L L+S + L +AL GND T Sbjct: 150 LPPGCTKQAIHTLRKMDVRILTCEEEADNELVRNLACIP-GAYAILGNDSDFYLMRGARFIPLE----HLEVTGAGPVCARVFSPELVAESLCLSS-DRLHELAALCGNDIT 255 The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig93377.21557.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 of Macrocystis pyrifera male vs UniRef90) Total hits: 1
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following polypeptide feature(s) derives from this mRNA:
The following CDS feature(s) are a part of this mRNA:
The following UTR feature(s) are a part of this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_M-pyrifera_M_contig93377.21557.1 >prot_M-pyrifera_M_contig93377.21557.1 ID=prot_M-pyrifera_M_contig93377.21557.1|Name=mRNA_M-pyrifera_M_contig93377.21557.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=104bp MWHAQTVLERNNVAVVRCMGEADFQLSADGADPAIGAYAVLSNDSDFFLSback to top mRNA from alignment at M-pyrifera_M_contig93377:305..679- Legend: UTRpolypeptideCDS Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_M-pyrifera_M_contig93377.21557.1 ID=mRNA_M-pyrifera_M_contig93377.21557.1|Name=mRNA_M-pyrifera_M_contig93377.21557.1|organism=Macrocystis pyrifera P11B4 male|type=mRNA|length=375bp|location=Sequence derived from alignment at M-pyrifera_M_contig93377:305..679- (Macrocystis pyrifera P11B4 male)back to top Coding sequence (CDS) from alignment at M-pyrifera_M_contig93377:305..679- >mRNA_M-pyrifera_M_contig93377.21557.1 ID=mRNA_M-pyrifera_M_contig93377.21557.1|Name=mRNA_M-pyrifera_M_contig93377.21557.1|organism=Macrocystis pyrifera P11B4 male|type=CDS|length=624bp|location=Sequence derived from alignment at M-pyrifera_M_contig93377:305..679- (Macrocystis pyrifera P11B4 male)back to top |