prot_M-pyrifera_M_contig93285.21538.1 (polypeptide) Macrocystis pyrifera P11B4 male
Overview
Homology
BLAST of mRNA_M-pyrifera_M_contig93285.21538.1 vs. uniprot
Match: D8LRK0_ECTSI (Nucleosome/chromatin assembly factor group n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D8LRK0_ECTSI) HSP 1 Score: 101 bits (251), Expect = 1.550e-23 Identity = 46/59 (77.97%), Postives = 49/59 (83.05%), Query Frame = 0 Query: 1 REFNRYWWFRGDPSVYIHVEAKGGGTWGQYKSQEEADALRDSQQPRGKRGAPLRQRLCQ 59 REFNRYWWF G PS IHVE KGG WGQY+SQ+E DAL DSQ PRGKRGAPLR+RLCQ Sbjct: 698 REFNRYWWFGGGPSEVIHVEEKGGDVWGQYRSQQEVDALMDSQHPRGKRGAPLRRRLCQ 756 The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig93285.21538.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 of Macrocystis pyrifera male vs UniRef90) Total hits: 1
InterPro
Analysis Name: InterProScan on OGS1.0 of Macrocystis pyrifera male
Date Performed: 2022-09-29
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_M-pyrifera_M_contig93285.21538.1 ID=prot_M-pyrifera_M_contig93285.21538.1|Name=mRNA_M-pyrifera_M_contig93285.21538.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=61bpback to top Annotated Terms
The following terms have been associated with this polypeptide:
|