prot_M-pyrifera_M_contig93096.21516.1 (polypeptide) Macrocystis pyrifera P11B4 male
Overview
Homology
BLAST of mRNA_M-pyrifera_M_contig93096.21516.1 vs. uniprot
Match: A0A556QVH6_9BACT (Ankyrin repeat domain-containing protein n=1 Tax=Cardinium endosymbiont of Dermatophagoides farinae TaxID=2597823 RepID=A0A556QVH6_9BACT) HSP 1 Score: 51.6 bits (122), Expect = 9.990e-6 Identity = 25/52 (48.08%), Postives = 35/52 (67.31%), Query Frame = 0 Query: 35 TLLHVAAEGGFWKLTQLLVRDFKAPLHARNAFGNTPLHLAEANGHKRVARLL 86 TLLHVAA G W+ QLL++D K ++ARN + +TP+H A A H V ++L Sbjct: 19 TLLHVAAFEGDWQKAQLLLKDKKIDVNARNNYYDTPMHYAVAQEHVEVLKVL 70
BLAST of mRNA_M-pyrifera_M_contig93096.21516.1 vs. uniprot
Match: A0A2S8FZA3_9BACT (Uncharacterized protein n=2 Tax=Pirellulaceae TaxID=2691357 RepID=A0A2S8FZA3_9BACT) HSP 1 Score: 50.8 bits (120), Expect = 4.090e-5 Identity = 30/64 (46.88%), Postives = 37/64 (57.81%), Query Frame = 0 Query: 23 VRVDARIGDQAQTLLHVAAEGGFWKLTQLLVRDFKAPLHARNAFGNTPLHLAEANGHKRVARLL 86 +R D R G+ T LH AA G +L Q+L+ D + PL ARNA G TPLHLA RV + L Sbjct: 135 LRQDPRSGEVGDTFLHTAARRGNDELCQILI-DEQLPLDARNAAGQTPLHLAAQWAPPRVVQTL 197 The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig93096.21516.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 of Macrocystis pyrifera male vs UniRef90) Total hits: 2
InterPro
Analysis Name: InterProScan on OGS1.0 of Macrocystis pyrifera male
Date Performed: 2022-09-29
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_M-pyrifera_M_contig93096.21516.1 ID=prot_M-pyrifera_M_contig93096.21516.1|Name=mRNA_M-pyrifera_M_contig93096.21516.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=110bpback to top |