mRNA_M-pyrifera_M_contig93096.21516.1 (mRNA) Macrocystis pyrifera P11B4 male
Overview
Homology
BLAST of mRNA_M-pyrifera_M_contig93096.21516.1 vs. uniprot
Match: A0A556QVH6_9BACT (Ankyrin repeat domain-containing protein n=1 Tax=Cardinium endosymbiont of Dermatophagoides farinae TaxID=2597823 RepID=A0A556QVH6_9BACT) HSP 1 Score: 51.6 bits (122), Expect = 9.990e-6 Identity = 25/52 (48.08%), Postives = 35/52 (67.31%), Query Frame = 1 Query: 103 TLLHVAAEGGFWKLTQLLVRDFKAPLHARNAFGNTPLHLAEANGHKRVARLL 258 TLLHVAA G W+ QLL++D K ++ARN + +TP+H A A H V ++L Sbjct: 19 TLLHVAAFEGDWQKAQLLLKDKKIDVNARNNYYDTPMHYAVAQEHVEVLKVL 70
BLAST of mRNA_M-pyrifera_M_contig93096.21516.1 vs. uniprot
Match: A0A2S8FZA3_9BACT (Uncharacterized protein n=2 Tax=Pirellulaceae TaxID=2691357 RepID=A0A2S8FZA3_9BACT) HSP 1 Score: 50.8 bits (120), Expect = 4.090e-5 Identity = 30/64 (46.88%), Postives = 37/64 (57.81%), Query Frame = 1 Query: 67 VRVDARIGDQAQTLLHVAAEGGFWKLTQLLVRDFKAPLHARNAFGNTPLHLAEANGHKRVARLL 258 +R D R G+ T LH AA G +L Q+L+ D + PL ARNA G TPLHLA RV + L Sbjct: 135 LRQDPRSGEVGDTFLHTAARRGNDELCQILI-DEQLPLDARNAAGQTPLHLAAQWAPPRVVQTL 197 The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig93096.21516.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 of Macrocystis pyrifera male vs UniRef90) Total hits: 2
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_M-pyrifera_M_contig93096.21516.1 >prot_M-pyrifera_M_contig93096.21516.1 ID=prot_M-pyrifera_M_contig93096.21516.1|Name=mRNA_M-pyrifera_M_contig93096.21516.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=110bp EAFGAAADNDIQAVGRLLLCGDVRVDARIGDQAQTLLHVAAEGGFWKLTQback to top mRNA from alignment at M-pyrifera_M_contig93096:323..652- Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_M-pyrifera_M_contig93096.21516.1 ID=mRNA_M-pyrifera_M_contig93096.21516.1|Name=mRNA_M-pyrifera_M_contig93096.21516.1|organism=Macrocystis pyrifera P11B4 male|type=mRNA|length=330bp|location=Sequence derived from alignment at M-pyrifera_M_contig93096:323..652- (Macrocystis pyrifera P11B4 male)back to top Coding sequence (CDS) from alignment at M-pyrifera_M_contig93096:323..652- >mRNA_M-pyrifera_M_contig93096.21516.1 ID=mRNA_M-pyrifera_M_contig93096.21516.1|Name=mRNA_M-pyrifera_M_contig93096.21516.1|organism=Macrocystis pyrifera P11B4 male|type=CDS|length=660bp|location=Sequence derived from alignment at M-pyrifera_M_contig93096:323..652- (Macrocystis pyrifera P11B4 male)back to top |