prot_M-pyrifera_M_contig93084.21512.1 (polypeptide) Macrocystis pyrifera P11B4 male
Overview
Homology
BLAST of mRNA_M-pyrifera_M_contig93084.21512.1 vs. uniprot
Match: A0A7S2WD98_9STRA (Hypothetical protein n=1 Tax=labyrinthulid quahog parasite QPX TaxID=96639 RepID=A0A7S2WD98_9STRA) HSP 1 Score: 58.9 bits (141), Expect = 2.140e-6 Identity = 33/88 (37.50%), Postives = 57/88 (64.77%), Query Frame = 0 Query: 148 KKRAFLEFLARQERTLRAKKEFAEEERKRSASAHRPRLCRKSLDMVKPETHGAFLERMQRDAVRKEQSALRERARASQDKDCTFAPEI 235 +++ F F+ARQ + K++ E+ K+ A H+P+LC+ S+ +VK G+FL+R+ +DA+RKE +R + R + D +CTF P+I Sbjct: 527 RRKNFDAFIARQNQREIRKQQKIEQVSKQIARTHKPKLCKNSVKIVKNNIQGSFLQRVAKDALRKEHETVRLKTR-NHDPECTFQPKI 613 The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig93084.21512.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 of Macrocystis pyrifera male vs UniRef90) Total hits: 1
InterPro
Analysis Name: InterProScan on OGS1.0 of Macrocystis pyrifera male
Date Performed: 2022-09-29
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_M-pyrifera_M_contig93084.21512.1 ID=prot_M-pyrifera_M_contig93084.21512.1|Name=mRNA_M-pyrifera_M_contig93084.21512.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=241bpback to top |