mRNA_M-pyrifera_M_contig93084.21512.1 (mRNA) Macrocystis pyrifera P11B4 male
Overview
Homology
BLAST of mRNA_M-pyrifera_M_contig93084.21512.1 vs. uniprot
Match: A0A7S2WD98_9STRA (Hypothetical protein n=1 Tax=labyrinthulid quahog parasite QPX TaxID=96639 RepID=A0A7S2WD98_9STRA) HSP 1 Score: 58.9 bits (141), Expect = 2.140e-6 Identity = 33/88 (37.50%), Postives = 57/88 (64.77%), Query Frame = 1 Query: 442 KKRAFLEFLARQERTLRAKKEFAEEERKRSASAHRPRLCRKSLDMVKPETHGAFLERMQRDAVRKEQSALRERARASQDKDCTFAPEI 705 +++ F F+ARQ + K++ E+ K+ A H+P+LC+ S+ +VK G+FL+R+ +DA+RKE +R + R + D +CTF P+I Sbjct: 527 RRKNFDAFIARQNQREIRKQQKIEQVSKQIARTHKPKLCKNSVKIVKNNIQGSFLQRVAKDALRKEHETVRLKTR-NHDPECTFQPKI 613 The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig93084.21512.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 of Macrocystis pyrifera male vs UniRef90) Total hits: 1
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_M-pyrifera_M_contig93084.21512.1 >prot_M-pyrifera_M_contig93084.21512.1 ID=prot_M-pyrifera_M_contig93084.21512.1|Name=mRNA_M-pyrifera_M_contig93084.21512.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=241bp SKGSGRARRDAGYEECTFQPKINKVPHSMGAVQAYLSKPAHERLSSHAVSback to top mRNA from alignment at M-pyrifera_M_contig93084:13..735- Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_M-pyrifera_M_contig93084.21512.1 ID=mRNA_M-pyrifera_M_contig93084.21512.1|Name=mRNA_M-pyrifera_M_contig93084.21512.1|organism=Macrocystis pyrifera P11B4 male|type=mRNA|length=723bp|location=Sequence derived from alignment at M-pyrifera_M_contig93084:13..735- (Macrocystis pyrifera P11B4 male)back to top Coding sequence (CDS) from alignment at M-pyrifera_M_contig93084:13..735- >mRNA_M-pyrifera_M_contig93084.21512.1 ID=mRNA_M-pyrifera_M_contig93084.21512.1|Name=mRNA_M-pyrifera_M_contig93084.21512.1|organism=Macrocystis pyrifera P11B4 male|type=CDS|length=1446bp|location=Sequence derived from alignment at M-pyrifera_M_contig93084:13..735- (Macrocystis pyrifera P11B4 male)back to top |