prot_M-pyrifera_M_contig92698.21442.1 (polypeptide) Macrocystis pyrifera P11B4 male
Overview
Homology
BLAST of mRNA_M-pyrifera_M_contig92698.21442.1 vs. uniprot
Match: A0A7S1K2W0_9ALVE (Hypothetical protein (Fragment) n=1 Tax=Vitrella brassicaformis TaxID=1169539 RepID=A0A7S1K2W0_9ALVE) HSP 1 Score: 52.4 bits (124), Expect = 3.230e-5 Identity = 24/49 (48.98%), Postives = 31/49 (63.27%), Query Frame = 0 Query: 76 DWERDSRGDGVLDYQEFTVGVFQLADFWTPVISEHAYAAFVNALTDKLT 124 DW DSRG L++ F FQLAD WTPVIS+ AY+ F+ L ++T Sbjct: 41 DWLHDSRGADALEFTRFFEAFFQLADVWTPVISDKAYSDFLTKLFKRIT 89
BLAST of mRNA_M-pyrifera_M_contig92698.21442.1 vs. uniprot
Match: A0A0G4FQA8_VITBC (Uncharacterized protein n=2 Tax=Vitrella brassicaformis TaxID=1169539 RepID=A0A0G4FQA8_VITBC) HSP 1 Score: 52.4 bits (124), Expect = 3.980e-5 Identity = 24/49 (48.98%), Postives = 31/49 (63.27%), Query Frame = 0 Query: 76 DWERDSRGDGVLDYQEFTVGVFQLADFWTPVISEHAYAAFVNALTDKLT 124 DW DSRG L++ F FQLAD WTPVIS+ AY+ F+ L ++T Sbjct: 100 DWLHDSRGADALEFTRFFEAFFQLADVWTPVISDKAYSDFLTKLFKRIT 148 The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig92698.21442.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 of Macrocystis pyrifera male vs UniRef90) Total hits: 2
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_M-pyrifera_M_contig92698.21442.1 ID=prot_M-pyrifera_M_contig92698.21442.1|Name=mRNA_M-pyrifera_M_contig92698.21442.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=137bpback to top |