mRNA_M-pyrifera_M_contig92698.21442.1 (mRNA) Macrocystis pyrifera P11B4 male
Overview
Homology
BLAST of mRNA_M-pyrifera_M_contig92698.21442.1 vs. uniprot
Match: A0A7S1K2W0_9ALVE (Hypothetical protein (Fragment) n=1 Tax=Vitrella brassicaformis TaxID=1169539 RepID=A0A7S1K2W0_9ALVE) HSP 1 Score: 52.4 bits (124), Expect = 3.230e-5 Identity = 24/49 (48.98%), Postives = 31/49 (63.27%), Query Frame = 1 Query: 226 DWERDSRGDGVLDYQEFTVGVFQLADFWTPVISEHAYAAFVNALTDKLT 372 DW DSRG L++ F FQLAD WTPVIS+ AY+ F+ L ++T Sbjct: 41 DWLHDSRGADALEFTRFFEAFFQLADVWTPVISDKAYSDFLTKLFKRIT 89
BLAST of mRNA_M-pyrifera_M_contig92698.21442.1 vs. uniprot
Match: A0A0G4FQA8_VITBC (Uncharacterized protein n=2 Tax=Vitrella brassicaformis TaxID=1169539 RepID=A0A0G4FQA8_VITBC) HSP 1 Score: 52.4 bits (124), Expect = 3.980e-5 Identity = 24/49 (48.98%), Postives = 31/49 (63.27%), Query Frame = 1 Query: 226 DWERDSRGDGVLDYQEFTVGVFQLADFWTPVISEHAYAAFVNALTDKLT 372 DW DSRG L++ F FQLAD WTPVIS+ AY+ F+ L ++T Sbjct: 100 DWLHDSRGADALEFTRFFEAFFQLADVWTPVISDKAYSDFLTKLFKRIT 148 The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig92698.21442.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 of Macrocystis pyrifera male vs UniRef90) Total hits: 2
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_M-pyrifera_M_contig92698.21442.1 >prot_M-pyrifera_M_contig92698.21442.1 ID=prot_M-pyrifera_M_contig92698.21442.1|Name=mRNA_M-pyrifera_M_contig92698.21442.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=137bp FYSRKALVTREAIRFSRTFQNAMLRLWRAFCATEGHTFMDETAYKLFFRQback to top mRNA from alignment at M-pyrifera_M_contig92698:176..586- Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_M-pyrifera_M_contig92698.21442.1 ID=mRNA_M-pyrifera_M_contig92698.21442.1|Name=mRNA_M-pyrifera_M_contig92698.21442.1|organism=Macrocystis pyrifera P11B4 male|type=mRNA|length=411bp|location=Sequence derived from alignment at M-pyrifera_M_contig92698:176..586- (Macrocystis pyrifera P11B4 male)back to top Coding sequence (CDS) from alignment at M-pyrifera_M_contig92698:176..586- >mRNA_M-pyrifera_M_contig92698.21442.1 ID=mRNA_M-pyrifera_M_contig92698.21442.1|Name=mRNA_M-pyrifera_M_contig92698.21442.1|organism=Macrocystis pyrifera P11B4 male|type=CDS|length=822bp|location=Sequence derived from alignment at M-pyrifera_M_contig92698:176..586- (Macrocystis pyrifera P11B4 male)back to top |