prot_M-pyrifera_M_contig92341.21375.1 (polypeptide) Macrocystis pyrifera P11B4 male
Overview
Homology
BLAST of mRNA_M-pyrifera_M_contig92341.21375.1 vs. uniprot
Match: A0A0L0D2J7_THETB (Uncharacterized protein n=1 Tax=Thecamonas trahens ATCC 50062 TaxID=461836 RepID=A0A0L0D2J7_THETB) HSP 1 Score: 57.4 bits (137), Expect = 7.880e-8 Identity = 30/67 (44.78%), Postives = 41/67 (61.19%), Query Frame = 0 Query: 12 VVPALPYELLAQNKGAMDNDNGIFYILGYNQSMT-VPNLVGVDVSSGDIVCDATLPFAESGFIGVGQ 77 V +LPYE Q +D + GI+YI+G N S + LVGV V++G++V + LPF S IGVGQ Sbjct: 46 VSSSLPYEAQGQGLATLDEELGIYYIIGTNVSASNAVKLVGVSVATGNVVAETPLPFQSSELIGVGQ 112 The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig92341.21375.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 of Macrocystis pyrifera male vs UniRef90) Total hits: 1
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_M-pyrifera_M_contig92341.21375.1 ID=prot_M-pyrifera_M_contig92341.21375.1|Name=mRNA_M-pyrifera_M_contig92341.21375.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=77bpback to top |