mRNA_M-pyrifera_M_contig92341.21375.1 (mRNA) Macrocystis pyrifera P11B4 male
Overview
Homology
BLAST of mRNA_M-pyrifera_M_contig92341.21375.1 vs. uniprot
Match: A0A0L0D2J7_THETB (Uncharacterized protein n=1 Tax=Thecamonas trahens ATCC 50062 TaxID=461836 RepID=A0A0L0D2J7_THETB) HSP 1 Score: 59.7 bits (143), Expect = 1.400e-8 Identity = 34/82 (41.46%), Postives = 49/82 (59.76%), Query Frame = 1 Query: 1 ALQEMNATTAAVIRTVVPALPYELLAQNKGAMDNDNGIFYILGYNQSMT-VPNLVGVDVSSGDIVCDATLPFAESGFIGVGQ 243 AL+ ++ TT + V +LPYE Q +D + GI+YI+G N S + LVGV V++G++V + LPF S IGVGQ Sbjct: 32 ALEAISTTTGQPVE-VSSSLPYEAQGQGLATLDEELGIYYIIGTNVSASNAVKLVGVSVATGNVVAETPLPFQSSELIGVGQ 112 The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig92341.21375.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 of Macrocystis pyrifera male vs UniRef90) Total hits: 1
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following UTR feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_M-pyrifera_M_contig92341.21375.1 >prot_M-pyrifera_M_contig92341.21375.1 ID=prot_M-pyrifera_M_contig92341.21375.1|Name=mRNA_M-pyrifera_M_contig92341.21375.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=77bp MNATTAAVIRTVVPALPYELLAQNKGAMDNDNGIFYILGYNQSMTVPNLVback to top mRNA from alignment at M-pyrifera_M_contig92341:2..244- Legend: UTRCDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_M-pyrifera_M_contig92341.21375.1 ID=mRNA_M-pyrifera_M_contig92341.21375.1|Name=mRNA_M-pyrifera_M_contig92341.21375.1|organism=Macrocystis pyrifera P11B4 male|type=mRNA|length=243bp|location=Sequence derived from alignment at M-pyrifera_M_contig92341:2..244- (Macrocystis pyrifera P11B4 male)back to top Coding sequence (CDS) from alignment at M-pyrifera_M_contig92341:2..244- >mRNA_M-pyrifera_M_contig92341.21375.1 ID=mRNA_M-pyrifera_M_contig92341.21375.1|Name=mRNA_M-pyrifera_M_contig92341.21375.1|organism=Macrocystis pyrifera P11B4 male|type=CDS|length=462bp|location=Sequence derived from alignment at M-pyrifera_M_contig92341:2..244- (Macrocystis pyrifera P11B4 male)back to top |