prot_M-pyrifera_M_contig92222.21347.1 (polypeptide) Macrocystis pyrifera P11B4 male
Overview
Homology
BLAST of mRNA_M-pyrifera_M_contig92222.21347.1 vs. uniprot
Match: A0A7S0DEK7_MICPS (Hypothetical protein (Fragment) n=2 Tax=Micromonas pusilla TaxID=38833 RepID=A0A7S0DEK7_MICPS) HSP 1 Score: 51.6 bits (122), Expect = 1.540e-5 Identity = 20/47 (42.55%), Postives = 30/47 (63.83%), Query Frame = 0 Query: 30 SECTYLTPIPEDWFC-PFFYYEDGHCDCNCGAPDSDCDVAHDEVFGC 75 SE + +P+DW C P++Y + CDC CGAPD DC++ ++GC Sbjct: 718 SESEPFSSVPDDWICAPWYYDQADGCDCTCGAPDPDCELPGQYLYGC 764 The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig92222.21347.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 of Macrocystis pyrifera male vs UniRef90) Total hits: 1
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_M-pyrifera_M_contig92222.21347.1 ID=prot_M-pyrifera_M_contig92222.21347.1|Name=mRNA_M-pyrifera_M_contig92222.21347.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=91bpback to top |