mRNA_M-pyrifera_M_contig92222.21347.1 (mRNA) Macrocystis pyrifera P11B4 male
Overview
Homology
BLAST of mRNA_M-pyrifera_M_contig92222.21347.1 vs. uniprot
Match: A0A7S0DEK7_MICPS (Hypothetical protein (Fragment) n=2 Tax=Micromonas pusilla TaxID=38833 RepID=A0A7S0DEK7_MICPS) HSP 1 Score: 51.6 bits (122), Expect = 1.540e-5 Identity = 20/47 (42.55%), Postives = 30/47 (63.83%), Query Frame = 1 Query: 88 SECTYLTPIPEDWFC-PFFYYEDGHCDCNCGAPDSDCDVAHDEVFGC 225 SE + +P+DW C P++Y + CDC CGAPD DC++ ++GC Sbjct: 718 SESEPFSSVPDDWICAPWYYDQADGCDCTCGAPDPDCELPGQYLYGC 764 The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig92222.21347.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 of Macrocystis pyrifera male vs UniRef90) Total hits: 1
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_M-pyrifera_M_contig92222.21347.1 >prot_M-pyrifera_M_contig92222.21347.1 ID=prot_M-pyrifera_M_contig92222.21347.1|Name=mRNA_M-pyrifera_M_contig92222.21347.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=91bp CGAYDPDCDLSGSIVFNCTQGSDPVCTAESECTYLTPIPEDWFCPFFYYEback to top mRNA from alignment at M-pyrifera_M_contig92222:6..278+ Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_M-pyrifera_M_contig92222.21347.1 ID=mRNA_M-pyrifera_M_contig92222.21347.1|Name=mRNA_M-pyrifera_M_contig92222.21347.1|organism=Macrocystis pyrifera P11B4 male|type=mRNA|length=273bp|location=Sequence derived from alignment at M-pyrifera_M_contig92222:6..278+ (Macrocystis pyrifera P11B4 male)back to top Coding sequence (CDS) from alignment at M-pyrifera_M_contig92222:6..278+ >mRNA_M-pyrifera_M_contig92222.21347.1 ID=mRNA_M-pyrifera_M_contig92222.21347.1|Name=mRNA_M-pyrifera_M_contig92222.21347.1|organism=Macrocystis pyrifera P11B4 male|type=CDS|length=546bp|location=Sequence derived from alignment at M-pyrifera_M_contig92222:6..278+ (Macrocystis pyrifera P11B4 male)back to top |