prot_M-pyrifera_M_contig9204.21311.1 (polypeptide) Macrocystis pyrifera P11B4 male
Overview
Homology
BLAST of mRNA_M-pyrifera_M_contig9204.21311.1 vs. uniprot
Match: D7FR74_ECTSI (EsV-1-7 n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D7FR74_ECTSI) HSP 1 Score: 58.9 bits (141), Expect = 7.170e-7 Identity = 23/53 (43.40%), Postives = 32/53 (60.38%), Query Frame = 0 Query: 1 HPFCTRRAGFNIDGTKKAEYCKQHAKDGMVDVISRRCSHAFCTKQPSFNVQGK 53 HP C R F + TKK ++C+ HA +GMVDV ++ C C K+P+F GK Sbjct: 11 HPNCNTRPAFGVPFTKKVQFCRPHALEGMVDVSTKSCGTHGCFKRPTFGFDGK 63
BLAST of mRNA_M-pyrifera_M_contig9204.21311.1 vs. uniprot
Match: A0A7S0TTT3_HEMAN (Hypothetical protein (Fragment) n=1 Tax=Hemiselmis andersenii TaxID=464988 RepID=A0A7S0TTT3_HEMAN) HSP 1 Score: 56.2 bits (134), Expect = 1.260e-6 Identity = 23/61 (37.70%), Postives = 33/61 (54.10%), Query Frame = 0 Query: 1 HPFCTRRAGFNIDGTKKAEYCKQHAKDGMVDVISRRCSHAFCTKQPSFNVQGKTASHCKEH 61 H C + F G K YC+QHA++G V++ +R C H C+ Q +F G A+ CK H Sbjct: 2 HDGCEKWPSFGPPGEKGGRYCRQHAREGDVNIKARMCVHEGCSSQATFGATGGKATACKLH 62
BLAST of mRNA_M-pyrifera_M_contig9204.21311.1 vs. uniprot
Match: A0A6H5J913_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5J913_9PHAE) HSP 1 Score: 56.2 bits (134), Expect = 5.850e-6 Identity = 24/53 (45.28%), Postives = 33/53 (62.26%), Query Frame = 0 Query: 2 PFCTRRAGFNIDGTKKAEYCKQHAKDGMVDVISRRCSHAFCTKQPSFNVQGKT 54 P CT + KKAE+CK+HAK GM++V++R+CSH C K SF G + Sbjct: 231 PECTTWPSYGAR-LKKAEFCKRHAKQGMINVVTRKCSHPGCIKSASFGKHGSS 282
BLAST of mRNA_M-pyrifera_M_contig9204.21311.1 vs. uniprot
Match: A0A6H5K5N3_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5K5N3_9PHAE) HSP 1 Score: 52.4 bits (124), Expect = 1.790e-5 Identity = 20/37 (54.05%), Postives = 26/37 (70.27%), Query Frame = 0 Query: 16 KKAEYCKQHAKDGMVDVISRRCSHAFCTKQPSFNVQG 52 K AE+C QH + MV+V+S+RC H CTKQPS+ G Sbjct: 20 KNAEFCSQHKQQDMVNVVSKRCGHPGCTKQPSYGRAG 56
BLAST of mRNA_M-pyrifera_M_contig9204.21311.1 vs. uniprot
Match: A0A6H5KW50_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5KW50_9PHAE) HSP 1 Score: 53.9 bits (128), Expect = 3.550e-5 Identity = 20/36 (55.56%), Postives = 27/36 (75.00%), Query Frame = 0 Query: 4 CTRRAGFNIDGTKKAEYCKQHAKDGMVDVISRRCSH 39 C++ F + GT+ AEYC HAKDGM++VIS+RC H Sbjct: 9 CSKVGSFGVQGTRTAEYCATHAKDGMLNVISKRCDH 44 The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig9204.21311.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 of Macrocystis pyrifera male vs UniRef90) Total hits: 5
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_M-pyrifera_M_contig9204.21311.1 ID=prot_M-pyrifera_M_contig9204.21311.1|Name=mRNA_M-pyrifera_M_contig9204.21311.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=190bpback to top |