prot_M-pyrifera_M_contig9199.21297.1 (polypeptide) Macrocystis pyrifera P11B4 male
Overview
Homology
BLAST of mRNA_M-pyrifera_M_contig9199.21297.1 vs. uniprot
Match: D7FHY2_ECTSI (Uncharacterized protein n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D7FHY2_ECTSI) HSP 1 Score: 73.6 bits (179), Expect = 5.870e-14 Identity = 32/55 (58.18%), Postives = 45/55 (81.82%), Query Frame = 0 Query: 1 MTFHKPEVVRIADNFIVDNQFNDEPVTGCTLGYVQEG-TTLVGFEFDDVCVEDTV 54 +TF KPEVVRI+DN ++ N++N +P+TGC+L YV+ TT+VGF+FDD+C E TV Sbjct: 342 VTFEKPEVVRISDNTLLANEYNPDPITGCSLAYVEGNETTVVGFDFDDICQEVTV 396 The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig9199.21297.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 of Macrocystis pyrifera male vs UniRef90) Total hits: 1
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_M-pyrifera_M_contig9199.21297.1 ID=prot_M-pyrifera_M_contig9199.21297.1|Name=mRNA_M-pyrifera_M_contig9199.21297.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=55bpback to top |