prot_M-pyrifera_M_contig91291.21159.1 (polypeptide) Macrocystis pyrifera P11B4 male
Overview
Homology
BLAST of mRNA_M-pyrifera_M_contig91291.21159.1 vs. uniprot
Match: A0A1J3DK21_NOCCA (Uncharacterized protein C6G9.01c n=1 Tax=Noccaea caerulescens TaxID=107243 RepID=A0A1J3DK21_NOCCA) HSP 1 Score: 67.8 bits (164), Expect = 3.890e-12 Identity = 35/67 (52.24%), Postives = 44/67 (65.67%), Query Frame = 0 Query: 52 EEEKRLVALRRLERAQKMANG-QRDPDDPVPVRYEEGLPVYTEEQLGMNKG--GGTALCPFDCDCCF 115 EE K +A + +R +K G ++P V R E+GLPVYTE++LG NK GGT LCPFDCDCCF Sbjct: 64 EETKVEIAKKNRKRKRKENGGLNKNPKTRVRKRTEDGLPVYTEDELGFNKAYAGGTPLCPFDCDCCF 130
BLAST of mRNA_M-pyrifera_M_contig91291.21159.1 vs. uniprot
Match: A0A1J3F0B4_NOCCA (Uncharacterized protein C6G9.01c (Fragment) n=2 Tax=Noccaea caerulescens TaxID=107243 RepID=A0A1J3F0B4_NOCCA) HSP 1 Score: 67.8 bits (164), Expect = 8.570e-12 Identity = 35/67 (52.24%), Postives = 44/67 (65.67%), Query Frame = 0 Query: 52 EEEKRLVALRRLERAQKMANG-QRDPDDPVPVRYEEGLPVYTEEQLGMNKG--GGTALCPFDCDCCF 115 EE K +A + +R +K G ++P V R E+GLPVYTE++LG NK GGT LCPFDCDCCF Sbjct: 101 EETKVEIAKKNRKRKRKENGGLNKNPKTRVRKRTEDGLPVYTEDELGFNKAYAGGTPLCPFDCDCCF 167
BLAST of mRNA_M-pyrifera_M_contig91291.21159.1 vs. uniprot
Match: A0A1J3IVD2_NOCCA (Uncharacterized protein C6G9.01c n=1 Tax=Noccaea caerulescens TaxID=107243 RepID=A0A1J3IVD2_NOCCA) HSP 1 Score: 65.1 bits (157), Expect = 3.950e-11 Identity = 28/44 (63.64%), Postives = 33/44 (75.00%), Query Frame = 0 Query: 74 RDPDDPVPVRYEEGLPVYTEEQLGMNKG--GGTALCPFDCDCCF 115 ++P V R E+GLPVYTE++LG NK GGT LCPFDCDCCF Sbjct: 83 KNPKTRVRKRTEDGLPVYTEDELGFNKAYAGGTPLCPFDCDCCF 126
BLAST of mRNA_M-pyrifera_M_contig91291.21159.1 vs. uniprot
Match: A0A061RCL0_9CHLO (Uncharacterized protein n=1 Tax=Tetraselmis sp. GSL018 TaxID=582737 RepID=A0A061RCL0_9CHLO) HSP 1 Score: 63.9 bits (154), Expect = 9.680e-11 Identity = 24/33 (72.73%), Postives = 27/33 (81.82%), Query Frame = 0 Query: 83 RYEEGLPVYTEEQLGMNKGGGTALCPFDCDCCF 115 R EEG P+Y EE+L +NKGG T LCPFDCDCCF Sbjct: 88 RTEEGFPIYNEEELKLNKGGDTDLCPFDCDCCF 120
BLAST of mRNA_M-pyrifera_M_contig91291.21159.1 vs. uniprot
Match: A0A0G4F5Z7_VITBC (Uncharacterized protein n=1 Tax=Vitrella brassicaformis (strain CCMP3155) TaxID=1169540 RepID=A0A0G4F5Z7_VITBC) HSP 1 Score: 64.3 bits (155), Expect = 1.900e-10 Identity = 26/36 (72.22%), Postives = 30/36 (83.33%), Query Frame = 0 Query: 81 PVRY-EEGLPVYTEEQLGMNKGGGTALCPFDCDCCF 115 P RY EEG P+YTEE+L + +GGGT LCPFDCDCCF Sbjct: 134 PRRYTEEGWPIYTEEELRIGQGGGTPLCPFDCDCCF 169
BLAST of mRNA_M-pyrifera_M_contig91291.21159.1 vs. uniprot
Match: D8LF26_ECTSI (Uncharacterized protein n=2 Tax=Ectocarpus TaxID=2879 RepID=D8LF26_ECTSI) HSP 1 Score: 64.3 bits (155), Expect = 2.390e-10 Identity = 26/40 (65.00%), Postives = 32/40 (80.00%), Query Frame = 0 Query: 77 DDPVPVRYE-EGLPVYTEEQLGMNKGGGTALCPFDCDCCF 115 D+ PVR++ EGLP+YT E L + +GGGTA CPFDCDCCF Sbjct: 143 DEVKPVRFDDEGLPIYTWESLRIGQGGGTAACPFDCDCCF 182
BLAST of mRNA_M-pyrifera_M_contig91291.21159.1 vs. uniprot
Match: A0A8K1CU05_PYTOL (Uncharacterized protein n=1 Tax=Pythium oligandrum TaxID=41045 RepID=A0A8K1CU05_PYTOL) HSP 1 Score: 63.9 bits (154), Expect = 5.500e-10 Identity = 27/36 (75.00%), Postives = 30/36 (83.33%), Query Frame = 0 Query: 81 PVRYEE-GLPVYTEEQLGMNKGGGTALCPFDCDCCF 115 PVRY+E GLP+YTEE L +NKGG TA CPFDC CCF Sbjct: 180 PVRYDEDGLPIYTEESLQINKGGDTAECPFDCWCCF 215
BLAST of mRNA_M-pyrifera_M_contig91291.21159.1 vs. uniprot
Match: A0A835K2X7_9ROSI (Uncharacterized protein n=2 Tax=Salix TaxID=40685 RepID=A0A835K2X7_9ROSI) HSP 1 Score: 63.2 bits (152), Expect = 5.550e-10 Identity = 27/43 (62.79%), Postives = 32/43 (74.42%), Query Frame = 0 Query: 75 DPDDPVPVRYEEGLPVYTEEQLGMNK--GGGTALCPFDCDCCF 115 DP + E+GL +YTEE+LG +K GGGTALCPFDCDCCF Sbjct: 130 DPPSRSRKKTEDGLNIYTEEELGFSKSSGGGTALCPFDCDCCF 172
BLAST of mRNA_M-pyrifera_M_contig91291.21159.1 vs. uniprot
Match: UPI000D1C7F07 (uncharacterized protein C6G9.01c-like n=2 Tax=Selaginella moellendorffii TaxID=88036 RepID=UPI000D1C7F07) HSP 1 Score: 60.5 bits (145), Expect = 1.290e-9 Identity = 25/35 (71.43%), Postives = 28/35 (80.00%), Query Frame = 0 Query: 83 RYEEGLPVYTEEQLGMNK--GGGTALCPFDCDCCF 115 + +EG VYTEE+LG NK GGTALCPFDCDCCF Sbjct: 64 KTQEGFSVYTEEELGCNKKDAGGTALCPFDCDCCF 98
BLAST of mRNA_M-pyrifera_M_contig91291.21159.1 vs. uniprot
Match: A0A3M6VH65_9STRA (Uncharacterized protein n=1 Tax=Peronospora effusa TaxID=542832 RepID=A0A3M6VH65_9STRA) HSP 1 Score: 62.4 bits (150), Expect = 2.050e-9 Identity = 26/39 (66.67%), Postives = 30/39 (76.92%), Query Frame = 0 Query: 78 DPVPVRYEE-GLPVYTEEQLGMNKGGGTALCPFDCDCCF 115 DP PVRY+E GLP+YTE L +N+GG T CPFDC CCF Sbjct: 176 DPRPVRYDEDGLPIYTEASLQINRGGNTKDCPFDCWCCF 214 The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig91291.21159.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 of Macrocystis pyrifera male vs UniRef90) Total hits: 25
Pagesback to topInterPro
Analysis Name: InterProScan on OGS1.0 of Macrocystis pyrifera male
Date Performed: 2022-09-29
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_M-pyrifera_M_contig91291.21159.1 ID=prot_M-pyrifera_M_contig91291.21159.1|Name=mRNA_M-pyrifera_M_contig91291.21159.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=116bpback to top Annotated Terms
The following terms have been associated with this polypeptide:
|