prot_M-pyrifera_M_contig90073.20881.1 (polypeptide) Macrocystis pyrifera P11B4 male
Overview
Homology
BLAST of mRNA_M-pyrifera_M_contig90073.20881.1 vs. uniprot
Match: A0A383ANL6_9ZZZZ (Uncharacterized protein (Fragment) n=1 Tax=marine metagenome TaxID=408172 RepID=A0A383ANL6_9ZZZZ) HSP 1 Score: 53.9 bits (128), Expect = 3.200e-6 Identity = 30/62 (48.39%), Postives = 42/62 (67.74%), Query Frame = 0 Query: 11 LRSAIREGDLEVVRKALQGGVWVDERDGVGNTPLHIAATVGDGEEHIEIVKLLLTEGADVHA 72 LR AIREGD+E V++ L G+ V+ +D G PLH+AA G H EI +LL+++ ADV+A Sbjct: 14 LREAIREGDIEAVKRHLAAGMDVNAKDDNGWNPLHLAAENG----HKEIAELLISKSADVNA 71 The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig90073.20881.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 of Macrocystis pyrifera male vs UniRef90) Total hits: 1
InterPro
Analysis Name: InterProScan on OGS1.0 of Macrocystis pyrifera male
Date Performed: 2022-09-29
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_M-pyrifera_M_contig90073.20881.1 ID=prot_M-pyrifera_M_contig90073.20881.1|Name=mRNA_M-pyrifera_M_contig90073.20881.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=120bpback to top |