prot_M-pyrifera_M_contig89983.20853.1 (polypeptide) Macrocystis pyrifera P11B4 male
Overview
Homology
BLAST of mRNA_M-pyrifera_M_contig89983.20853.1 vs. uniprot
Match: A0A7C2B262_9BACT (Glycosyltransferase family 1 protein n=1 Tax=Planctomycetes bacterium TaxID=2026780 RepID=A0A7C2B262_9BACT) HSP 1 Score: 87.4 bits (215), Expect = 8.550e-18 Identity = 51/120 (42.50%), Postives = 68/120 (56.67%), Query Frame = 0 Query: 1 LGVAANVHWIQDDPAAH-PELFGTATLFVAPGADERASSRWPCAALAAGLPILAADVERHRWAVAHEERGLLVPEQTRAAWEAALTRSATAPVARERWGRSARAFAEEHLDWAHIAARFE 119 LG+ + V W+ P L G +TLF P + R ALA GLP+LA+D+ R R +V GLLV AW A+ R+A++PVAR+RW R AR +AEEHL W +A+ FE Sbjct: 269 LGIGSRVTWLPRPRREELPGLMGASTLFAVPAVGDTVVGRQLGRALACGLPVLASDLPRLRDSVEDGRVGLLVEPGNVEAWVDAIGRAASSPVARKRWSREARRYAEEHLSWDRVASEFE 388 The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig89983.20853.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 of Macrocystis pyrifera male vs UniRef90) Total hits: 1
InterPro
Analysis Name: InterProScan on OGS1.0 of Macrocystis pyrifera male
Date Performed: 2022-09-29
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_M-pyrifera_M_contig89983.20853.1 ID=prot_M-pyrifera_M_contig89983.20853.1|Name=mRNA_M-pyrifera_M_contig89983.20853.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=122bpback to top Annotated Terms
The following terms have been associated with this polypeptide:
|