prot_M-pyrifera_M_contig89766.20806.1 (polypeptide) Macrocystis pyrifera P11B4 male
Overview
Homology
BLAST of mRNA_M-pyrifera_M_contig89766.20806.1 vs. uniprot
Match: A0A7W1VWH1_9BACT (IPT/TIG domain-containing protein n=1 Tax=Verrucomicrobia bacterium TaxID=2026799 RepID=A0A7W1VWH1_9BACT) HSP 1 Score: 55.5 bits (132), Expect = 1.600e-6 Identity = 35/115 (30.43%), Postives = 60/115 (52.17%), Query Frame = 0 Query: 1 GQGTDLVVKVYIQGSWSNSVTYSYSPPIITRLTATEPAESGDPWTLHIVGSNFGVSNEVLVRPLVGGSPYTLLSTVSSSHTTIVVTLSEDEGEVSVQSGGQTSNSRIYSQASPII 115 G GT V V + G S +++++Y+PP IT + T SG+ + + G++FG S VL G+P + S S +V + +SV +GGQ SN ++++ +SP + Sbjct: 411 GVGTGHTVSVSVGGQDSGALSFNYNPPFITDVFPTSAPTSGNT-LVTLTGASFGTSGTVLFN----GNPCAISSYTHSQIQFVVPPGQGMDNSISVVTGGQPSNMKLFNYSSPSV 520 The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig89766.20806.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 of Macrocystis pyrifera male vs UniRef90) Total hits: 1
InterPro
Analysis Name: InterProScan on OGS1.0 of Macrocystis pyrifera male
Date Performed: 2022-09-29
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_M-pyrifera_M_contig89766.20806.1 ID=prot_M-pyrifera_M_contig89766.20806.1|Name=mRNA_M-pyrifera_M_contig89766.20806.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=115bpback to top |