prot_M-pyrifera_M_contig89619.20778.1 (polypeptide) Macrocystis pyrifera P11B4 male
Overview
Homology
BLAST of mRNA_M-pyrifera_M_contig89619.20778.1 vs. uniprot
Match: A0A7X7KBU0_9BACT (Protein kinase (Fragment) n=1 Tax=Pirellulaceae bacterium TaxID=2699754 RepID=A0A7X7KBU0_9BACT) HSP 1 Score: 72.8 bits (177), Expect = 1.020e-12 Identity = 47/105 (44.76%), Postives = 59/105 (56.19%), Query Frame = 0 Query: 1 LTKLQAAQAPRIVDICQLAPETPQPLATAIAACLRMRPEHRPESFARLSAMLGPATKRDTAALAGFMRGEGPGRVRLRTTASTARHSRWTSVWAAATAGCLVSLA 105 L+KL++A+ I D+ + AP+ P PLA AIA+C P RPES ARLSAMLGP T+ L + G VRL T A + R S +W A A C V LA Sbjct: 283 LSKLRSAEECLIRDVREYAPDAPPPLAAAIASCAWKDPRRRPESMARLSAMLGPPTRDGRERLIAALNRRGRPAVRLTTAARSIRRSNNAPIWLTAAACCAVLLA 387 The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig89619.20778.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 of Macrocystis pyrifera male vs UniRef90) Total hits: 1
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_M-pyrifera_M_contig89619.20778.1 ID=prot_M-pyrifera_M_contig89619.20778.1|Name=mRNA_M-pyrifera_M_contig89619.20778.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=108bpback to top |