prot_M-pyrifera_M_contig8955.20761.1 (polypeptide) Macrocystis pyrifera P11B4 male
Overview
Homology
BLAST of mRNA_M-pyrifera_M_contig8955.20761.1 vs. uniprot
Match: D8LF73_ECTSI (Uncharacterized protein n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D8LF73_ECTSI) HSP 1 Score: 102 bits (255), Expect = 8.070e-24 Identity = 49/72 (68.06%), Postives = 61/72 (84.72%), Query Frame = 0 Query: 1 MISTRIENPEIALLAFAESEGNALLAAKRISEGRAYLNELFLAADIIHVTVFLTALKKPGKRGAGALWREGV 72 MI+TR+ENP +ALLA AES GN LAA+R+++ RAY+NEL LAADI++V VFL AL KPGKRG+GALWR G+ Sbjct: 866 MIATRVENPGLALLALAESRGNVSLAARRVTDERAYINELCLAADIVNVEVFLKALTKPGKRGSGALWRAGL 937
BLAST of mRNA_M-pyrifera_M_contig8955.20761.1 vs. uniprot
Match: A0A6H5L7C1_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5L7C1_9PHAE) HSP 1 Score: 92.0 bits (227), Expect = 4.890e-20 Identity = 44/72 (61.11%), Postives = 60/72 (83.33%), Query Frame = 0 Query: 1 MISTRIENPEIALLAFAESEGNALLAAKRISEGRAYLNELFLAADIIHVTVFLTALKKPGKRGAGALWREGV 72 MI+TR+E+P +ALLA AES G+ LAA+R+++ RAY++EL LAADI++V VFL AL+KPGKR +GALW G+ Sbjct: 635 MIATRVEDPGVALLALAESRGSVSLAARRVADKRAYIDELCLAADIVNVEVFLRALRKPGKRVSGALWCAGL 706 The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig8955.20761.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 of Macrocystis pyrifera male vs UniRef90) Total hits: 2
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_M-pyrifera_M_contig8955.20761.1 ID=prot_M-pyrifera_M_contig8955.20761.1|Name=mRNA_M-pyrifera_M_contig8955.20761.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=75bpback to top |