prot_M-pyrifera_M_contig88633.20578.1 (polypeptide) Macrocystis pyrifera P11B4 male
Overview
Homology
BLAST of mRNA_M-pyrifera_M_contig88633.20578.1 vs. uniprot
Match: K3X201_GLOUD (Uncharacterized protein n=1 Tax=Globisporangium ultimum (strain ATCC 200006 / CBS 805.95 / DAOM BR144) TaxID=431595 RepID=K3X201_GLOUD) HSP 1 Score: 58.9 bits (141), Expect = 3.300e-7 Identity = 42/137 (30.66%), Postives = 65/137 (47.45%), Query Frame = 0 Query: 22 ALELFLLAADGDGSGDAMYNAAVMIRDGLADKPPDPVRARELLARASRETANFGAVYDLGCMLLFGKGGQWELEGA-VQTLGHAARVAGPWGKLFRRAFDRYRHRDYVGATLDYLHTASQGLELGAADAAYLLDRGL 157 ALE F AA + GD+++NA GL P + RA A+++ +F A+ ++G + + G G E T AA AG WGK R+ F+RY + D+ A Y G + ++ A+L D+ L Sbjct: 211 ALEFFEKAAANEEDGDSVFNAGYCHAFGLGT-PINFTRAIHFYEIAAKKFGHFDAILEMGKIWMVGISGVVERNNEFAHTYLKAASDAGRWGKCVRKGFERYLNNDFQRAAALYHEAREYGYPVATSNLAFLYDQKL 346 The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig88633.20578.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 of Macrocystis pyrifera male vs UniRef90) Total hits: 1
InterPro
Analysis Name: InterProScan on OGS1.0 of Macrocystis pyrifera male
Date Performed: 2022-09-29
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_M-pyrifera_M_contig88633.20578.1 ID=prot_M-pyrifera_M_contig88633.20578.1|Name=mRNA_M-pyrifera_M_contig88633.20578.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=159bpback to top |