prot_M-pyrifera_M_contig8731.20294.1 (polypeptide) Macrocystis pyrifera P11B4 male
Overview
Homology
BLAST of mRNA_M-pyrifera_M_contig8731.20294.1 vs. uniprot
Match: A0A6H5JLA9_9PHAE (HeH domain-containing protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5JLA9_9PHAE) HSP 1 Score: 62.0 bits (149), Expect = 7.460e-10 Identity = 28/49 (57.14%), Postives = 36/49 (73.47%), Query Frame = 0 Query: 5 DDDWAVLSPAELKRKTVAQLKGYLDEEGVGYPGKVKKADLLDIVTSFLA 53 D DW LS + RKTVA LK +LDEEG+ YP K+KKA+L+D+V + LA Sbjct: 914 DGDWGALSAKAVGRKTVAALKEFLDEEGIDYPSKIKKAELVDMVLNMLA 962
BLAST of mRNA_M-pyrifera_M_contig8731.20294.1 vs. uniprot
Match: D7FLN9_ECTSI (Uncharacterized protein n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D7FLN9_ECTSI) HSP 1 Score: 61.2 bits (147), Expect = 1.390e-9 Identity = 28/49 (57.14%), Postives = 36/49 (73.47%), Query Frame = 0 Query: 5 DDDWAVLSPAELKRKTVAQLKGYLDEEGVGYPGKVKKADLLDIVTSFLA 53 D DW LS + RKTVA LK +LDEEG+ YP K+KKA+L+D+V + LA Sbjct: 563 DGDWGALSAKAVGRKTVAALKEFLDEEGMDYPSKIKKAELVDMVLNMLA 611 The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig8731.20294.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 of Macrocystis pyrifera male vs UniRef90) Total hits: 2
InterPro
Analysis Name: InterProScan on OGS1.0 of Macrocystis pyrifera male
Date Performed: 2022-09-29
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_M-pyrifera_M_contig8731.20294.1 ID=prot_M-pyrifera_M_contig8731.20294.1|Name=mRNA_M-pyrifera_M_contig8731.20294.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=54bpback to top Annotated Terms
The following terms have been associated with this polypeptide:
|