prot_M-pyrifera_M_contig86117.20073.1 (polypeptide) Macrocystis pyrifera P11B4 male
Overview
Homology
BLAST of mRNA_M-pyrifera_M_contig86117.20073.1 vs. uniprot
Match: A0A2N0DM69_9PSED (RING-type E3 ubiquitin transferase n=3 Tax=Pseudomonas TaxID=286 RepID=A0A2N0DM69_9PSED) HSP 1 Score: 54.3 bits (129), Expect = 5.480e-6 Identity = 44/122 (36.07%), Postives = 65/122 (53.28%), Query Frame = 0 Query: 3 GLEVLVLSFNHLSHLPD-LSSLPSLRRLSASHNRLTSLSFPLEKVPGEMGRLGDIKTLQWLDVGHNYVSSLLPLSGSSSLETLWCQNNRLSDAKGVLRVLETLPSLRGLVVESNPFLTLQNI 123 G+ L L+ N L+ LP+ +++LP+LRRLSASHNRL++ P L + LQ LD+ N++ L +S + LE L NRL G + TLP+LR L + N T+ + Sbjct: 1883 GVHTLELNGNQLTMLPEPVTALPALRRLSASHNRLSAS-------PALQTHLSALTHLQSLDLSQNWLEEL-DVSALTGLERLVLHGNRLVYWPGGVL---TLPALRALDLRDNMIETIPQV 1993 The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig86117.20073.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 of Macrocystis pyrifera male vs UniRef90) Total hits: 1
InterPro
Analysis Name: InterProScan on OGS1.0 of Macrocystis pyrifera male
Date Performed: 2022-09-29
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_M-pyrifera_M_contig86117.20073.1 ID=prot_M-pyrifera_M_contig86117.20073.1|Name=mRNA_M-pyrifera_M_contig86117.20073.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=123bpback to top |