prot_M-pyrifera_M_contig85986.20040.1 (polypeptide) Macrocystis pyrifera P11B4 male
Overview
Homology
BLAST of mRNA_M-pyrifera_M_contig85986.20040.1 vs. uniprot
Match: K6Z211_9ALTE (Cytosine-specific methyltransferase n=2 Tax=Paraglaciecola TaxID=1621534 RepID=K6Z211_9ALTE) HSP 1 Score: 59.7 bits (143), Expect = 1.770e-8 Identity = 38/89 (42.70%), Postives = 54/89 (60.67%), Query Frame = 0 Query: 1 MLAFRHDIAKKIDANSQDLTLKKALEESFNFYDLVHNGNEGLPYGHLQFHDVENGSGLYDR---HSILAHQVRHRDEKPVVSEKEATDE 86 MLAFR ++ +I N+ D L +ALE S F+ LV L YGHL++HDVENGS +Y+ SI+A +R K +++ KEA D+ Sbjct: 235 MLAFRKNVFAQILKNNTDNALSEALENSHQFFKLVSKEGGELEYGHLKYHDVENGSPIYNSTIFESIVA--MRSATNK-LITTKEAIDD 320 The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig85986.20040.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 of Macrocystis pyrifera male vs UniRef90) Total hits: 1
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_M-pyrifera_M_contig85986.20040.1 ID=prot_M-pyrifera_M_contig85986.20040.1|Name=mRNA_M-pyrifera_M_contig85986.20040.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=86bpback to top |