prot_M-pyrifera_M_contig85784.20002.1 (polypeptide) Macrocystis pyrifera P11B4 male
Overview
Homology
BLAST of mRNA_M-pyrifera_M_contig85784.20002.1 vs. uniprot
Match: D7FR05_ECTSI (SGF29 C-terminal domain-containing protein n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D7FR05_ECTSI) HSP 1 Score: 60.5 bits (145), Expect = 9.260e-10 Identity = 28/32 (87.50%), Postives = 31/32 (96.88%), Query Frame = 0 Query: 4 EQVLAVFPDTTSFYRGTISKQPVRKAGLVSEV 35 + VLAVFPDTTSFYRGTISKQPVRKAGLV+E+ Sbjct: 197 DDVLAVFPDTTSFYRGTISKQPVRKAGLVAEL 228 The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig85784.20002.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 of Macrocystis pyrifera male vs UniRef90) Total hits: 1
InterPro
Analysis Name: InterProScan on OGS1.0 of Macrocystis pyrifera male
Date Performed: 2022-09-29
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_M-pyrifera_M_contig85784.20002.1 ID=prot_M-pyrifera_M_contig85784.20002.1|Name=mRNA_M-pyrifera_M_contig85784.20002.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=38bpback to top Annotated Terms
The following terms have been associated with this polypeptide:
|