prot_M-pyrifera_M_contig85448.19922.1 (polypeptide) Macrocystis pyrifera P11B4 male
Overview
Homology
BLAST of mRNA_M-pyrifera_M_contig85448.19922.1 vs. uniprot
Match: A0A521KR86_9BACT (VCBS repeat-containing protein (Fragment) n=1 Tax=Planctomycetes bacterium TaxID=2026780 RepID=A0A521KR86_9BACT) HSP 1 Score: 55.5 bits (132), Expect = 4.290e-6 Identity = 29/49 (59.18%), Postives = 35/49 (71.43%), Query Frame = 0 Query: 6 LARRELALGGRPLGLVAHDFDADGFDDLAVVLESPGEVAVFAGTDQGLA 54 LARRELAL G+P L A D D DG D+LAV L+SPG + V+ GT G+A Sbjct: 88 LARRELALPGKPACLWAGDLDGDGRDELAVALQSPGRLLVWRGTATGIA 136 The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig85448.19922.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 of Macrocystis pyrifera male vs UniRef90) Total hits: 1
InterPro
Analysis Name: InterProScan on OGS1.0 of Macrocystis pyrifera male
Date Performed: 2022-09-29
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_M-pyrifera_M_contig85448.19922.1 ID=prot_M-pyrifera_M_contig85448.19922.1|Name=mRNA_M-pyrifera_M_contig85448.19922.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=263bpback to top Annotated Terms
The following terms have been associated with this polypeptide:
|