prot_M-pyrifera_M_contig85223.19862.1 (polypeptide) Macrocystis pyrifera P11B4 male
Overview
Homology
BLAST of mRNA_M-pyrifera_M_contig85223.19862.1 vs. uniprot
Match: A0A6J5N8Z0_9CAUD (Intramolecular chaperone auto-processing domain containing protein n=1 Tax=uncultured Caudovirales phage TaxID=2100421 RepID=A0A6J5N8Z0_9CAUD) HSP 1 Score: 51.6 bits (122), Expect = 9.950e-5 Identity = 30/56 (53.57%), Postives = 34/56 (60.71%), Query Frame = 0 Query: 72 LGRTTFEAHDGTSYLVGASMEATFTDTTRGTGDGGSRLAFSTAADGANTPTERLSI 127 LG TF DGT Y+ A+ A F D T GT D RL FST ADGA +PTER+ I Sbjct: 1017 LGALTFRGDDGTDYVSQAASIAAFVDGTPGTNDMPGRLVFSTTADGAASPTERMRI 1072 The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig85223.19862.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 of Macrocystis pyrifera male vs UniRef90) Total hits: 1
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_M-pyrifera_M_contig85223.19862.1 ID=prot_M-pyrifera_M_contig85223.19862.1|Name=mRNA_M-pyrifera_M_contig85223.19862.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=149bpback to top |