prot_M-pyrifera_M_contig84957.19800.1 (polypeptide) Macrocystis pyrifera P11B4 male
Overview
Homology
BLAST of mRNA_M-pyrifera_M_contig84957.19800.1 vs. uniprot
Match: A0A061S375_9CHLO (Light-gated proton channel rhodopsin n=3 Tax=Tetraselmis sp. GSL018 TaxID=582737 RepID=A0A061S375_9CHLO) HSP 1 Score: 50.1 bits (118), Expect = 7.680e-5 Identity = 30/79 (37.97%), Postives = 44/79 (55.70%), Query Frame = 0 Query: 1 VYVDDGEVSRRFFPALRYLGWLVTCPILVAHMHGLPIGMKHKDPRRTLSALVVNQVMTCFGVASVLF-GGTARIVLFVI 78 VY G V+ P LRY+ WL+TCP+++ H+ L G+ + RT+ L +Q CFGV + L G +I+ FVI Sbjct: 102 VYSVFGPVT----PWLRYIEWLLTCPVILIHLSNLT-GLDEEYSARTMHLLTADQGTICFGVTAALSPNGWIKILCFVI 175 The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig84957.19800.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 of Macrocystis pyrifera male vs UniRef90) Total hits: 1
InterPro
Analysis Name: InterProScan on OGS1.0 of Macrocystis pyrifera male
Date Performed: 2022-09-29
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_M-pyrifera_M_contig84957.19800.1 ID=prot_M-pyrifera_M_contig84957.19800.1|Name=mRNA_M-pyrifera_M_contig84957.19800.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=102bpback to top Annotated Terms
The following terms have been associated with this polypeptide:
|