|
|
Homology
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterProScan on OGS1.0 of Macrocystis pyrifera male
Date Performed: 2022-09-29
| IPR Term | IPR Description | Source | Source Term | Source Description | Alignment |
|---|
| None | No IPR available | COILS | Coil | Coil | coord: 57..83 |
| IPR000048 | IQ motif, EF-hand binding site | SMART | SM00015 | iq_5 | coord: 179..201
e-value: 36.0
score: 9.1
coord: 49..71
e-value: 170.0
score: 3.5
coord: 23..45
e-value: 17.0
score: 11.7
coord: 127..149
e-value: 55.0
score: 7.6
coord: 153..175
e-value: 11.0
score: 13.2
coord: 101..123
e-value: 7.9
score: 14.6
coord: 75..97
e-value: 77.0
score: 6.3
coord: 205..227
e-value: 290.0
score: 1.6
coord: 231..253
e-value: 19.0
score: 11.4 |
| IPR000048 | IQ motif, EF-hand binding site | PFAM | PF00612 | IQ | coord: 26..44
e-value: 0.1
score: 12.4
coord: 239..251
e-value: 0.15
score: 11.9
coord: 105..122
e-value: 0.21
score: 11.5
coord: 183..197
e-value: 0.16
score: 11.8
coord: 155..174
e-value: 0.089
score: 12.6 |
| IPR000048 | IQ motif, EF-hand binding site | PROSITE | PS50096 | IQ | coord: 76..105
score: 7.821 |
| IPR000048 | IQ motif, EF-hand binding site | PROSITE | PS50096 | IQ | coord: 232..261
score: 8.48 |
| IPR000048 | IQ motif, EF-hand binding site | PROSITE | PS50096 | IQ | coord: 102..131
score: 9.487 |
| IPR000048 | IQ motif, EF-hand binding site | PROSITE | PS50096 | IQ | coord: 154..183
score: 7.547 |
| IPR000048 | IQ motif, EF-hand binding site | PROSITE | PS50096 | IQ | coord: 24..53
score: 7.913 |
| IPR000048 | IQ motif, EF-hand binding site | PROSITE | PS50096 | IQ | coord: 128..157
score: 7.254 |
| IPR027417 | P-loop containing nucleoside triphosphate hydrolase | SUPERFAMILY | 52540 | P-loop containing nucleoside triphosphate hydrolases | coord: 102..180 |
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_M-pyrifera_M_contig82206.19227.1 ID=prot_M-pyrifera_M_contig82206.19227.1|Name=mRNA_M-pyrifera_M_contig82206.19227.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=275bp
VIQTAVRSWKARQVLTERKVELKRKKSAVRIQAIARSRKAKKELQVLRVR
RDSAVVLQSIARRRKAEQELVRRKEQRDAATRIQATLRMRAAKKERELRA
KRRTSAIRISAMVRGRAARKRYEELRTMHQKALLVERMWRGHVARVMASE
KRAERKAAVLVQALCRRLLAGREVRRRRRELVAAVFMQCAWRRKVARDVV
QAKREERDAAREVQKLWRARSARKFVAVERKRRASSFHIQRLARGFLARS
QTTKMRRERNAQSIIAREWRAHRVR back to top
Annotated Terms
The following terms have been associated with this polypeptide:
|