prot_M-pyrifera_M_contig81643.19109.1 (polypeptide) Macrocystis pyrifera P11B4 male
Overview
Homology
BLAST of mRNA_M-pyrifera_M_contig81643.19109.1 vs. uniprot
Match: A0A0D2X5D7_CAPO3 (Kinesin family member 1C n=2 Tax=Capsaspora owczarzaki (strain ATCC 30864) TaxID=595528 RepID=A0A0D2X5D7_CAPO3) HSP 1 Score: 51.2 bits (121), Expect = 1.720e-5 Identity = 24/72 (33.33%), Postives = 40/72 (55.56%), Query Frame = 0 Query: 10 YHTFTVKVAAGKLTWNAEPRFSDFVAFHKTVRKLFPSLPLMKFPSKQPTKKQTEQFVRKRALKLERYLRAAL 81 +H + V++ G W+ + R+S F FH +R FPS + FP ++ + FV +R ++LE YLR A+ Sbjct: 1370 FHFYIVRIRVGDNVWDLQRRYSQFREFHLAIRSKFPSGVKIMFPPRKTIGHRNPDFVERRRIRLESYLRCAI 1441 The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig81643.19109.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 of Macrocystis pyrifera male vs UniRef90) Total hits: 1
InterPro
Analysis Name: InterProScan on OGS1.0 of Macrocystis pyrifera male
Date Performed: 2022-09-29
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_M-pyrifera_M_contig81643.19109.1 ID=prot_M-pyrifera_M_contig81643.19109.1|Name=mRNA_M-pyrifera_M_contig81643.19109.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=85bpback to top |