prot_M-pyrifera_M_contig81489.19066.1 (polypeptide) Macrocystis pyrifera P11B4 male

You are viewing a polypeptide, more information available on the corresponding mRNA page

Overview


Name	mRNA_M-pyrifera_M_contig81489.19066.1
Unique Name	prot_M-pyrifera_M_contig81489.19066.1
Type	polypeptide
Organism	Macrocystis pyrifera P11B4 male (Macrocystis pyrifera P11B4 male (Giant kelp))
Sequence length	133

Homology

[Close]

BLAST of mRNA_M-pyrifera_M_contig81489.19066.1 vs. uniprot
Match: A0A847L4R5_9BACT (AraC family transcriptional regulator n=1 Tax=Bacteroidales bacterium TaxID=2030927 RepID=A0A847L4R5_9BACT)

HSP 1 Score: 52.4 bits (124), Expect = 2.920e-5
Identity = 29/112 (25.89%), Postives = 55/112 (49.11%), Query Frame = 0

Query:   14 IGLVLSVIMAIAFGLESKKRFANFWFTCFLIASAVVFIVKLLYSTGQIVNYPHWFKLNYPAGILRPVFFYLYIDFLLNGSTRIKTKYFLHFIPFALLSIYLLPFFQMDEAYK 125
            +G+ LS+ +A     +  K  ++     +++  A+      L+  G  V YPH   + +P  +L     YLY+ F L    R + K ++HF+PF +  ++++PFF +    K
Sbjct:    7 VGIFLSLFLATLLLTKRNKSLSDNILGAWMLVMAIHLSSYYLHYLGYWVKYPHLVGIAHPFPLLYGPLLYLYVVFSLRSDQRWRWKDWMHFLPFVVTYLFMIPFFSLSAEQK 118

The following BLAST results are available for this feature:

BLAST of mRNA_M-pyrifera_M_contig81489.19066.1 vs. uniprot

BLAST of mRNA_M-pyrifera_M_contig81489.19066.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 of Macrocystis pyrifera male vs UniRef90)
Total hits: 1


Match Name	E-value	Identity	Description
A0A847L4R5_9BACT	2.920e-5	25.89	AraC family transcriptional regulator n=1 Tax=Bact...	[more]

InterPro

Analysis Name: InterProScan on OGS1.0 of Macrocystis pyrifera male
Date Performed: 2022-09-29


IPR Term	IPR Description	Source	Source Term	Source Description	Alignment
None	No IPR available	PHOBIUS	NON_CYTOPLASMIC_DOMAIN	Non cytoplasmic domain	coord: 1..5
None	No IPR available	PHOBIUS	CYTOPLASMIC_DOMAIN	Cytoplasmic domain	coord: 94..99
None	No IPR available	PHOBIUS	TRANSMEMBRANE	Transmembrane region	coord: 35..56
None	No IPR available	PHOBIUS	TRANSMEMBRANE	Transmembrane region	coord: 100..118
None	No IPR available	PHOBIUS	CYTOPLASMIC_DOMAIN	Cytoplasmic domain	coord: 29..34
None	No IPR available	PHOBIUS	TRANSMEMBRANE	Transmembrane region	coord: 76..93
None	No IPR available	PHOBIUS	NON_CYTOPLASMIC_DOMAIN	Non cytoplasmic domain	coord: 57..75
None	No IPR available	PHOBIUS	TRANSMEMBRANE	Transmembrane region	coord: 6..28
None	No IPR available	PHOBIUS	NON_CYTOPLASMIC_DOMAIN	Non cytoplasmic domain	coord: 119..133
None	No IPR available	TMHMM	TMhelix		coord: 10..27
None	No IPR available	TMHMM	TMhelix		coord: 34..56
None	No IPR available	TMHMM	TMhelix		coord: 71..93
None	No IPR available	TMHMM	TMhelix		coord: 100..119

Alignments

The following features are aligned


Aligned Feature	Feature Type	Alignment Location
M-pyrifera_M_contig81489	contig	M-pyrifera_M_contig81489:183..581 -

Analyses

This polypeptide is derived from or has results from the following analyses


Analysis Name	Date Performed
InterProScan on OGS1.0 of Macrocystis pyrifera male	2022-09-29
Diamond blastp: OGS1.0 of Macrocystis pyrifera male vs UniRef90	2022-09-16
OGS1.0 of Macrocystis pyrifera P11B4 male	2021-02-24

Relationships

This polypeptide derives from the following mRNA feature(s):


Feature Name	Unique Name	Species	Type	Position
mRNA_M-pyrifera_M_contig81489.19066.1	mRNA_M-pyrifera_M_contig81489.19066.1	Macrocystis pyrifera P11B4 male	mRNA	M-pyrifera_M_contig81489 183..581 -

Sequences

The following sequences are available for this feature:

polypeptide sequence

polypeptide sequence

>prot_M-pyrifera_M_contig81489.19066.1 ID=prot_M-pyrifera_M_contig81489.19066.1|Name=mRNA_M-pyrifera_M_contig81489.19066.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=133bp
MDLRLNFNELLLLIGLVLSVIMAIAFGLESKKRFANFWFTCFLIASAVVF
IVKLLYSTGQIVNYPHWFKLNYPAGILRPVFFYLYIDFLLNGSTRIKTKY
FLHFIPFALLSIYLLPFFQMDEAYKVDVLYRRI