prot_M-pyrifera_M_contig81317.19021.1 (polypeptide) Macrocystis pyrifera P11B4 male
Overview
Homology
BLAST of mRNA_M-pyrifera_M_contig81317.19021.1 vs. uniprot
Match: A0A3M1DBJ2_9BACT (Uncharacterized protein (Fragment) n=1 Tax=Candidatus Parcubacteria bacterium TaxID=2762014 RepID=A0A3M1DBJ2_9BACT) HSP 1 Score: 51.6 bits (122), Expect = 3.660e-5 Identity = 25/63 (39.68%), Postives = 37/63 (58.73%), Query Frame = 0 Query: 22 ERTISVAVPAGTYSVTAASYDGYDNRETT--GVQEYEQYVLQFLDAGGNVLDTTTPTADLPEG 82 + T V +PAG Y+++ SYDGY+ RE T Q EQ+ + +D+ G + T PT DL +G Sbjct: 92 QETQPVTLPAGRYTISYYSYDGYEGREKTDPNTQNKEQWNMLLIDSSGKTITTFGPTPDLKDG 154 The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig81317.19021.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 of Macrocystis pyrifera male vs UniRef90) Total hits: 1
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_M-pyrifera_M_contig81317.19021.1 ID=prot_M-pyrifera_M_contig81317.19021.1|Name=mRNA_M-pyrifera_M_contig81317.19021.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=120bpback to top |