|
|
Homology
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterProScan on OGS1.0 of Macrocystis pyrifera male
Date Performed: 2022-09-29
| IPR Term | IPR Description | Source | Source Term | Source Description | Alignment |
|---|
| None | No IPR available | COILS | Coil | Coil | coord: 306..309 |
| None | No IPR available | COILS | Coil | Coil | coord: 210..230 |
| None | No IPR available | PFAM | PF13374 | TPR_10 | coord: 197..233
e-value: 0.0014
score: 18.4
coord: 7..23
e-value: 0.014
score: 15.2 |
| None | No IPR available | PFAM | PF13424 | TPR_12 | coord: 38..97
e-value: 2.0E-14
score: 53.6
coord: 237..308
e-value: 1.6E-17
score: 63.6
coord: 114..180
e-value: 2.9E-14
score: 53.1 |
| None | No IPR available | PANTHER | PTHR45641 | FAMILY NOT NAMED | coord: 72..309
coord: 2..94 |
| IPR019734 | Tetratricopeptide repeat | SMART | SM00028 | tpr_5 | coord: 151..184
e-value: 0.28
score: 20.3
coord: 109..142
e-value: 72.0
score: 7.4
coord: 235..268
e-value: 0.0057
score: 25.9
coord: 277..309
e-value: 19.0
score: 12.5
coord: 25..58
e-value: 0.075
score: 22.1
coord: 67..100
e-value: 0.0039
score: 26.4 |
| IPR019734 | Tetratricopeptide repeat | PROSITE | PS50005 | TPR | coord: 25..58
score: 8.467 |
| IPR019734 | Tetratricopeptide repeat | PROSITE | PS50005 | TPR | coord: 151..184
score: 7.493 |
| IPR019734 | Tetratricopeptide repeat | PROSITE | PS50005 | TPR | coord: 67..100
score: 10.089 |
| IPR019734 | Tetratricopeptide repeat | PROSITE | PS50005 | TPR | coord: 277..309
score: 5.458 |
| IPR019734 | Tetratricopeptide repeat | PROSITE | PS50005 | TPR | coord: 109..142
score: 5.487 |
| IPR019734 | Tetratricopeptide repeat | PROSITE | PS50005 | TPR | coord: 235..268
score: 10.561 |
| IPR011990 | Tetratricopeptide-like helical domain superfamily | GENE3D | 1.25.40.10 | | coord: 137..309
e-value: 3.3E-43
score: 149.8 |
| IPR011990 | Tetratricopeptide-like helical domain superfamily | GENE3D | 1.25.40.10 | | coord: 1..136
e-value: 1.3E-40
score: 141.3 |
| IPR011990 | Tetratricopeptide-like helical domain superfamily | SUPERFAMILY | 48452 | TPR-like | coord: 2..227 |
| IPR011990 | Tetratricopeptide-like helical domain superfamily | SUPERFAMILY | 48452 | TPR-like | coord: 187..308 |
| IPR013026 | Tetratricopeptide repeat-containing domain | PROSITE | PS50293 | TPR_REGION | coord: 25..309
score: 24.486 |
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_M-pyrifera_M_contig81132.18978.1 ID=prot_M-pyrifera_M_contig81132.18978.1|Name=mRNA_M-pyrifera_M_contig81132.18978.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=309bp
KATSYTEECLEIRRQVFGNAHPETAASLNNLGSLYVTLKRYSKAEPLLKE
SLNLARTQLGPKHQGTVSAMINLGSLYEAMGKYKQAETLYQQILSVMTQN
YGKDHYRTSVVHDKMAKLYLQMQAYPQAEQHMQQCHTIRQKSLGETHPET
VNALHERGRIYVMQEKYAAAEPIFLKCLELVSSETGENHLQTTILRDNLV
MIFDHLDKYSEAEQLMLKNLKIRRDSLNQKHPDLLYSLNSLGNYYYARQE
YSQALPYFKEALEITQKTRGIEHPATAVAFGRLGNLYRMQGKKSEAEPLL
SQSLKINQK back to top
Annotated Terms
The following terms have been associated with this polypeptide:
|