prot_M-pyrifera_M_contig80923.18926.1 (polypeptide) Macrocystis pyrifera P11B4 male
Overview
Homology
BLAST of mRNA_M-pyrifera_M_contig80923.18926.1 vs. uniprot
Match: A0A358A500_9ACTN (Uncharacterized protein n=1 Tax=Acidimicrobiaceae bacterium TaxID=2024894 RepID=A0A358A500_9ACTN) HSP 1 Score: 74.7 bits (182), Expect = 2.660e-16 Identity = 35/67 (52.24%), Postives = 45/67 (67.16%), Query Frame = 0 Query: 1 VSVDTRTKGRRLDGYTRQTVDGHQFLLDPDLLKLPIELTITTGGLFGRGLSATADGLNGAACPIELL 67 +SVDTR GRRLD Y R+ V L+D DL +LP+E+T+ GL GRGL DG++GA CPI L+ Sbjct: 1 MSVDTRATGRRLDIYHRKQVGDVVILIDRDLARLPVEVTVMKSGLLGRGLGVHVDGVDGAPCPINLV 67
BLAST of mRNA_M-pyrifera_M_contig80923.18926.1 vs. uniprot
Match: A0A2D8GHZ1_9ACTN (Uncharacterized protein n=1 Tax=Acidimicrobiaceae bacterium TaxID=2024894 RepID=A0A2D8GHZ1_9ACTN) HSP 1 Score: 72.8 bits (177), Expect = 1.540e-15 Identity = 33/67 (49.25%), Postives = 44/67 (65.67%), Query Frame = 0 Query: 1 VSVDTRTKGRRLDGYTRQTVDGHQFLLDPDLLKLPIELTITTGGLFGRGLSATADGLNGAACPIELL 67 +SVDTR GRRLD Y + V L+D DL +LP+E+T+ GL GRG+ DG++GA CPI L+ Sbjct: 1 MSVDTRATGRRLDAYHQTQVGDIVVLIDRDLARLPVEVTVMKSGLLGRGVGVHVDGIDGALCPINLV 67
BLAST of mRNA_M-pyrifera_M_contig80923.18926.1 vs. uniprot
Match: A0A2D8LVQ1_9ACTN (Uncharacterized protein n=2 Tax=Acidimicrobiaceae bacterium TaxID=2024894 RepID=A0A2D8LVQ1_9ACTN) HSP 1 Score: 71.2 bits (173), Expect = 6.250e-15 Identity = 32/67 (47.76%), Postives = 43/67 (64.18%), Query Frame = 0 Query: 1 VSVDTRTKGRRLDGYTRQTVDGHQFLLDPDLLKLPIELTITTGGLFGRGLSATADGLNGAACPIELL 67 +SVDTR GRRLD Y R + L+D DL +L +E+T+ GL GRG+ DG++GA CPI L+ Sbjct: 1 MSVDTRATGRRLDSYHRTQIGDIVVLIDRDLARLSVEVTVMKSGLLGRGIGVHVDGVDGAPCPINLI 67
BLAST of mRNA_M-pyrifera_M_contig80923.18926.1 vs. uniprot
Match: A0A2E0T267_9ACTN (Uncharacterized protein n=2 Tax=Acidimicrobiaceae bacterium TaxID=2024894 RepID=A0A2E0T267_9ACTN) HSP 1 Score: 67.4 bits (163), Expect = 2.090e-13 Identity = 32/67 (47.76%), Postives = 41/67 (61.19%), Query Frame = 0 Query: 1 VSVDTRTKGRRLDGYTRQTVDGHQFLLDPDLLKLPIELTITTGGLFGRGLSATADGLNGAACPIELL 67 +SVDTR GRRLD Y V L+D DL +L +E+T+ GL GRG DG++GA CPI L+ Sbjct: 1 MSVDTRATGRRLDAYHXTQVGDIVVLIDHDLARLXVEVTVMKSGLXGRGXGVHVDGVDGAPCPINLV 67 The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig80923.18926.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 of Macrocystis pyrifera male vs UniRef90) Total hits: 4
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_M-pyrifera_M_contig80923.18926.1 ID=prot_M-pyrifera_M_contig80923.18926.1|Name=mRNA_M-pyrifera_M_contig80923.18926.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=68bpback to top |