prot_M-pyrifera_M_contig8030.18816.1 (polypeptide) Macrocystis pyrifera P11B4 male
Overview
Homology
BLAST of mRNA_M-pyrifera_M_contig8030.18816.1 vs. uniprot
Match: D8LM76_ECTSI (Uncharacterized protein n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D8LM76_ECTSI) HSP 1 Score: 107 bits (266), Expect = 3.160e-27 Identity = 44/74 (59.46%), Postives = 62/74 (83.78%), Query Frame = 0 Query: 1 MPVWDRVQMSLGLGKWSYAGLGLALFIIFLNNWLGVGWLTRAMTPDFDTEGLVDIEQRGQQIQVMPMDDPSNLL 74 MPVW++VQ +LGLG WSY GLGLA+FII LNN LGVGW T+ + P+++ + +++++Q+G+QIQ MP+DD SNLL Sbjct: 142 MPVWEKVQAALGLGVWSYVGLGLAVFIIVLNNVLGVGWATKIINPEYEPDSVLEVQQQGRQIQYMPLDDASNLL 215
BLAST of mRNA_M-pyrifera_M_contig8030.18816.1 vs. uniprot
Match: A0A6H5KPT2_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5KPT2_9PHAE) HSP 1 Score: 107 bits (266), Expect = 1.440e-26 Identity = 44/74 (59.46%), Postives = 62/74 (83.78%), Query Frame = 0 Query: 1 MPVWDRVQMSLGLGKWSYAGLGLALFIIFLNNWLGVGWLTRAMTPDFDTEGLVDIEQRGQQIQVMPMDDPSNLL 74 MPVW++VQ +LGLG WSY GLGLA+FII LNN LGVGW T+ + P+++ + +++++Q+G+QIQ MP+DD SNLL Sbjct: 213 MPVWEKVQAALGLGVWSYVGLGLAVFIIVLNNVLGVGWATKIINPEYEPDSVLEVQQQGRQIQYMPLDDASNLL 286 The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig8030.18816.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 of Macrocystis pyrifera male vs UniRef90) Total hits: 2
InterPro
Analysis Name: InterProScan on OGS1.0 of Macrocystis pyrifera male
Date Performed: 2022-09-29
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_M-pyrifera_M_contig8030.18816.1 ID=prot_M-pyrifera_M_contig8030.18816.1|Name=mRNA_M-pyrifera_M_contig8030.18816.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=75bpback to top |