prot_M-pyrifera_M_contig7988.18742.1 (polypeptide) Macrocystis pyrifera P11B4 male
Overview
Homology
BLAST of mRNA_M-pyrifera_M_contig7988.18742.1 vs. uniprot
Match: D7FLH8_ECTSI (FAM184 domain-containing protein n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D7FLH8_ECTSI) HSP 1 Score: 75.5 bits (184), Expect = 1.730e-14 Identity = 41/57 (71.93%), Postives = 43/57 (75.44%), Query Frame = 0 Query: 3 GSSSVGSAEATNATTTTGGGSMKPGEVFPDLHHKMSKKIAQLTKVIYHLNTKNEDRQ 59 GSS SA T+GG MK +VFPDLHHKMSKKIAQLTKVIYHLNTKNEDRQ Sbjct: 50 GSSGPPSATTVAEAATSGGTPMKAADVFPDLHHKMSKKIAQLTKVIYHLNTKNEDRQ 106
BLAST of mRNA_M-pyrifera_M_contig7988.18742.1 vs. uniprot
Match: A0A6H5KR93_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5KR93_9PHAE) HSP 1 Score: 73.9 bits (180), Expect = 6.040e-14 Identity = 36/42 (85.71%), Postives = 38/42 (90.48%), Query Frame = 0 Query: 18 TTGGGSMKPGEVFPDLHHKMSKKIAQLTKVIYHLNTKNEDRQ 59 T+GG MK +VFPDLHHKMSKKIAQLTKVIYHLNTKNEDRQ Sbjct: 32 TSGGTPMKAADVFPDLHHKMSKKIAQLTKVIYHLNTKNEDRQ 73
BLAST of mRNA_M-pyrifera_M_contig7988.18742.1 vs. uniprot
Match: A0A7S3UP41_HETAK (Hypothetical protein (Fragment) n=1 Tax=Heterosigma akashiwo TaxID=2829 RepID=A0A7S3UP41_HETAK) HSP 1 Score: 69.3 bits (168), Expect = 1.500e-12 Identity = 33/36 (91.67%), Postives = 33/36 (91.67%), Query Frame = 0 Query: 24 MKPGEVFPDLHHKMSKKIAQLTKVIYHLNTKNEDRQ 59 MK EVFPDLHHKMSKKIAQLTKVIYHLNTKNED Q Sbjct: 11 MKASEVFPDLHHKMSKKIAQLTKVIYHLNTKNEDHQ 46
BLAST of mRNA_M-pyrifera_M_contig7988.18742.1 vs. uniprot
Match: A0A482SQX4_9ARCH (FAM184 domain-containing protein n=1 Tax=archaeon TaxID=1906665 RepID=A0A482SQX4_9ARCH) HSP 1 Score: 65.1 bits (157), Expect = 3.270e-12 Identity = 31/33 (93.94%), Postives = 31/33 (93.94%), Query Frame = 0 Query: 25 KPGEVFPDLHHKMSKKIAQLTKVIYHLNTKNED 57 K EVFPDLHHKMSKKIAQLTKVIYHLNTKNED Sbjct: 9 KTMEVFPDLHHKMSKKIAQLTKVIYHLNTKNED 41
BLAST of mRNA_M-pyrifera_M_contig7988.18742.1 vs. uniprot
Match: A0A835ZEA9_9STRA (B30.2/SPRY domain-containing protein n=1 Tax=Tribonema minus TaxID=303371 RepID=A0A835ZEA9_9STRA) HSP 1 Score: 68.9 bits (167), Expect = 3.500e-12 Identity = 32/33 (96.97%), Postives = 33/33 (100.00%), Query Frame = 0 Query: 27 GEVFPDLHHKMSKKIAQLTKVIYHLNTKNEDRQ 59 G+VFPDLHHKMSKKIAQLTKVIYHLNTKNEDRQ Sbjct: 13 GDVFPDLHHKMSKKIAQLTKVIYHLNTKNEDRQ 45
BLAST of mRNA_M-pyrifera_M_contig7988.18742.1 vs. uniprot
Match: A0A7R9UEV8_9STRA (Hypothetical protein (Fragment) n=1 Tax=Pinguiococcus pyrenoidosus TaxID=172671 RepID=A0A7R9UEV8_9STRA) HSP 1 Score: 63.2 bits (152), Expect = 3.380e-11 Identity = 29/32 (90.62%), Postives = 31/32 (96.88%), Query Frame = 0 Query: 29 VFPDLHHKMSKKIAQLTKVIYHLNTKNEDRQA 60 VFPD+HHKMSKKIAQLTKVIYHLNTKNED +A Sbjct: 10 VFPDVHHKMSKKIAQLTKVIYHLNTKNEDHEA 41
BLAST of mRNA_M-pyrifera_M_contig7988.18742.1 vs. uniprot
Match: A0A7S1XST5_9STRA (Hypothetical protein (Fragment) n=1 Tax=Phaeomonas parva TaxID=124430 RepID=A0A7S1XST5_9STRA) HSP 1 Score: 62.4 bits (150), Expect = 7.020e-10 Identity = 28/32 (87.50%), Postives = 31/32 (96.88%), Query Frame = 0 Query: 29 VFPDLHHKMSKKIAQLTKVIYHLNTKNEDRQA 60 +FPD+HHKMSKKIAQLTKVIYHLNTKNED +A Sbjct: 23 MFPDIHHKMSKKIAQLTKVIYHLNTKNEDHEA 54
BLAST of mRNA_M-pyrifera_M_contig7988.18742.1 vs. uniprot
Match: A0A7S0HLU0_9CRYP (Hypothetical protein (Fragment) n=2 Tax=Hanusia phi TaxID=3032 RepID=A0A7S0HLU0_9CRYP) HSP 1 Score: 60.1 bits (144), Expect = 4.590e-9 Identity = 27/29 (93.10%), Postives = 29/29 (100.00%), Query Frame = 0 Query: 29 VFPDLHHKMSKKIAQLTKVIYHLNTKNED 57 +FPDLHHKMSKKIAQLTKVIYHLN+KNED Sbjct: 54 LFPDLHHKMSKKIAQLTKVIYHLNSKNED 82
BLAST of mRNA_M-pyrifera_M_contig7988.18742.1 vs. uniprot
Match: L1IJW8_GUITC (FAM184 domain-containing protein n=1 Tax=Guillardia theta (strain CCMP2712) TaxID=905079 RepID=L1IJW8_GUITC) HSP 1 Score: 60.1 bits (144), Expect = 4.630e-9 Identity = 27/29 (93.10%), Postives = 29/29 (100.00%), Query Frame = 0 Query: 29 VFPDLHHKMSKKIAQLTKVIYHLNTKNED 57 +FPDLHHKMSKKIAQLTKVIYHLN+KNED Sbjct: 7 LFPDLHHKMSKKIAQLTKVIYHLNSKNED 35
BLAST of mRNA_M-pyrifera_M_contig7988.18742.1 vs. uniprot
Match: UPI001CFF2F7B (uncharacterized protein n=1 Tax=Naegleria lovaniensis TaxID=51637 RepID=UPI001CFF2F7B) HSP 1 Score: 58.5 bits (140), Expect = 6.280e-9 Identity = 26/28 (92.86%), Postives = 27/28 (96.43%), Query Frame = 0 Query: 30 FPDLHHKMSKKIAQLTKVIYHLNTKNED 57 FPD HHKMSKKIAQLTKVIYHLNTKN+D Sbjct: 23 FPDFHHKMSKKIAQLTKVIYHLNTKNDD 50 The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig7988.18742.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 of Macrocystis pyrifera male vs UniRef90) Total hits: 25
Pagesback to topInterPro
Analysis Name: InterProScan on OGS1.0 of Macrocystis pyrifera male
Date Performed: 2022-09-29
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_M-pyrifera_M_contig7988.18742.1 ID=prot_M-pyrifera_M_contig7988.18742.1|Name=mRNA_M-pyrifera_M_contig7988.18742.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=60bpback to top Annotated Terms
The following terms have been associated with this polypeptide:
|