prot_M-pyrifera_M_contig7935.18634.1 (polypeptide) Macrocystis pyrifera P11B4 male
Overview
Homology
BLAST of mRNA_M-pyrifera_M_contig7935.18634.1 vs. uniprot
Match: D7G5J5_ECTSI (Uncharacterized protein n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D7G5J5_ECTSI) HSP 1 Score: 91.7 bits (226), Expect = 7.140e-21 Identity = 42/48 (87.50%), Postives = 44/48 (91.67%), Query Frame = 0 Query: 1 MEGFAGFPLPAGLGPEFAGQPRRRLPKAPPLEIMRDEHDLSQYCLQDD 48 MEGFAGFPL GLGPEFAGQPRRRLPKAP LEIMR EHDLS+YCLQD+ Sbjct: 74 MEGFAGFPLAPGLGPEFAGQPRRRLPKAPSLEIMRGEHDLSEYCLQDE 121
BLAST of mRNA_M-pyrifera_M_contig7935.18634.1 vs. uniprot
Match: A0A6H5JUZ5_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5JUZ5_9PHAE) HSP 1 Score: 91.7 bits (226), Expect = 2.110e-20 Identity = 42/48 (87.50%), Postives = 44/48 (91.67%), Query Frame = 0 Query: 1 MEGFAGFPLPAGLGPEFAGQPRRRLPKAPPLEIMRDEHDLSQYCLQDD 48 MEGFAGFPL GLGPEFAGQPRRRLPKAP LEIMR EHDLS+YCLQD+ Sbjct: 73 MEGFAGFPLAPGLGPEFAGQPRRRLPKAPSLEIMRGEHDLSEYCLQDE 120 The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig7935.18634.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 of Macrocystis pyrifera male vs UniRef90) Total hits: 2
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_M-pyrifera_M_contig7935.18634.1 ID=prot_M-pyrifera_M_contig7935.18634.1|Name=mRNA_M-pyrifera_M_contig7935.18634.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=48bpback to top |