prot_M-pyrifera_M_contig7930.18619.1 (polypeptide) Macrocystis pyrifera P11B4 male
Overview
Homology
BLAST of mRNA_M-pyrifera_M_contig7930.18619.1 vs. uniprot
Match: A0A8C6WYF3_9GOBI (Tubulin alpha chain n=1 Tax=Neogobius melanostomus TaxID=47308 RepID=A0A8C6WYF3_9GOBI) HSP 1 Score: 56.2 bits (134), Expect = 3.830e-7 Identity = 36/53 (67.92%), Postives = 37/53 (69.81%), Query Frame = 0 Query: 37 SASPSTLARPASRPVTRAGSSTAWSTGSSPMARCPRTRPSVAVTMLSTLSSPR 89 S SPST ARP R VT AGS TAWS GSSPM RCP T+PS T LST SS R Sbjct: 8 SVSPSTWARPVCRSVTPAGSCTAWSMGSSPMDRCPVTKPSEEETTLSTPSSAR 60
BLAST of mRNA_M-pyrifera_M_contig7930.18619.1 vs. uniprot
Match: UPI001155CECC (uncharacterized protein LOC115305219 n=2 Tax=Suricata suricatta TaxID=37032 RepID=UPI001155CECC) HSP 1 Score: 50.8 bits (120), Expect = 3.090e-5 Identity = 37/59 (62.71%), Postives = 38/59 (64.41%), Query Frame = 0 Query: 35 CASASPSTLARPASRPVTRAGSSTAWSTGSSPMARCPRTRPSVAVTMLSTLSSPRPVSA 93 CASASPSTLAR R AGSSTAW+T SSPMARC TRP ST SS R V A Sbjct: 204 CASASPSTLARLVFRSAMPAGSSTAWNTASSPMARCQVTRPLGEEMTPSTPSSVRRVLA 262
BLAST of mRNA_M-pyrifera_M_contig7930.18619.1 vs. uniprot
Match: A0A060XZL2_ONCMY (Uncharacterized protein (Fragment) n=1 Tax=Oncorhynchus mykiss TaxID=8022 RepID=A0A060XZL2_ONCMY) HSP 1 Score: 50.1 bits (118), Expect = 6.090e-5 Identity = 32/56 (57.14%), Postives = 36/56 (64.29%), Query Frame = 0 Query: 35 CASASPSTLARPASRPVTRAGSSTAWSTGSSPMARCPRTRPSVAVTMLSTLSSPRP 90 C SAS STL RP R AG+ TAW+ GSSPM RCP T+PS +TLSS RP Sbjct: 1019 CVSASLSTLVRPVFRSGMPAGNCTAWNMGSSPMGRCPVTKPSAEGMTHATLSSARP 1074 The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig7930.18619.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 of Macrocystis pyrifera male vs UniRef90) Total hits: 3
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_M-pyrifera_M_contig7930.18619.1 ID=prot_M-pyrifera_M_contig7930.18619.1|Name=mRNA_M-pyrifera_M_contig7930.18619.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=94bpback to top |