prot_M-pyrifera_M_contig79223.18596.1 (polypeptide) Macrocystis pyrifera P11B4 male
Overview
Homology
BLAST of mRNA_M-pyrifera_M_contig79223.18596.1 vs. uniprot
Match: A0A2H0WTB6_9BACT (Uncharacterized protein n=1 Tax=Candidatus Roizmanbacteria bacterium CG09_land_8_20_14_0_10_41_9 TaxID=1974850 RepID=A0A2H0WTB6_9BACT) HSP 1 Score: 61.6 bits (148), Expect = 2.300e-9 Identity = 33/90 (36.67%), Postives = 54/90 (60.00%), Query Frame = 0 Query: 1 VPNFVGHDIQ-LSYQKFLDRWFVDFDFSFIGK-----VLEIGSGYGQLALNLLPRANEYICLDLDTQSLVQILKQEKISGLVADKHKLPI 84 +P + G DI+ +Y KFL R+ + ++F ++ K +L+IGSG G+LAL L ++ C D+D +SL +I K++K+ L KL I Sbjct: 39 LPTYAGADIEEKNYMKFLKRFILTYEFGYLKKRQPMRILDIGSGSGELALQLSKFGHDVTCNDIDKKSLARISKRQKLKTLYGSIEKLSI 128 The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig79223.18596.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 of Macrocystis pyrifera male vs UniRef90) Total hits: 1
InterPro
Analysis Name: InterProScan on OGS1.0 of Macrocystis pyrifera male
Date Performed: 2022-09-29
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_M-pyrifera_M_contig79223.18596.1 ID=prot_M-pyrifera_M_contig79223.18596.1|Name=mRNA_M-pyrifera_M_contig79223.18596.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=84bpback to top Annotated Terms
The following terms have been associated with this polypeptide:
|