prot_M-pyrifera_M_contig78833.18520.1 (polypeptide) Macrocystis pyrifera P11B4 male
Overview
Homology
BLAST of mRNA_M-pyrifera_M_contig78833.18520.1 vs. uniprot
Match: A0A2E7KC48_9PLAN (Exonuclease n=5 Tax=Gimesia TaxID=1649453 RepID=A0A2E7KC48_9PLAN) HSP 1 Score: 104 bits (260), Expect = 7.040e-27 Identity = 50/50 (100.00%), Postives = 50/50 (100.00%), Query Frame = 0 Query: 1 LVSRLRRHFLEGFQKPNDPMKVYYEHLAIVSMFRSGKLEPSIQALISNID 50 LVSRLRRHFLEGFQKPNDPMKVYYEHLAIVSMFRSGKLEPSIQALISNID Sbjct: 157 LVSRLRRHFLEGFQKPNDPMKVYYEHLAIVSMFRSGKLEPSIQALISNID 206
BLAST of mRNA_M-pyrifera_M_contig78833.18520.1 vs. uniprot
Match: A0A518A3B8_9PLAN (Putative HTH-type transcriptional regulator YdfH n=5 Tax=Gimesia TaxID=1649453 RepID=A0A518A3B8_9PLAN) HSP 1 Score: 103 bits (257), Expect = 1.990e-26 Identity = 49/50 (98.00%), Postives = 50/50 (100.00%), Query Frame = 0 Query: 1 LVSRLRRHFLEGFQKPNDPMKVYYEHLAIVSMFRSGKLEPSIQALISNID 50 LVSR+RRHFLEGFQKPNDPMKVYYEHLAIVSMFRSGKLEPSIQALISNID Sbjct: 157 LVSRVRRHFLEGFQKPNDPMKVYYEHLAIVSMFRSGKLEPSIQALISNID 206
BLAST of mRNA_M-pyrifera_M_contig78833.18520.1 vs. uniprot
Match: A6CBF7_9PLAN (Exonuclease n=11 Tax=Planctomycetaceae TaxID=126 RepID=A6CBF7_9PLAN) HSP 1 Score: 98.2 bits (243), Expect = 2.530e-24 Identity = 45/50 (90.00%), Postives = 49/50 (98.00%), Query Frame = 0 Query: 1 LVSRLRRHFLEGFQKPNDPMKVYYEHLAIVSMFRSGKLEPSIQALISNID 50 LVSRLRRHFL GFQKPNDPMKVYYEH+AIV+MFR+GKLEPS+QALISNID Sbjct: 157 LVSRLRRHFLAGFQKPNDPMKVYYEHVAIVAMFRTGKLEPSLQALISNID 206
BLAST of mRNA_M-pyrifera_M_contig78833.18520.1 vs. uniprot
Match: A0A518I9F6_9PLAN (Putative HTH-type transcriptional regulator YdfH n=2 Tax=Gimesia TaxID=1649453 RepID=A0A518I9F6_9PLAN) HSP 1 Score: 93.6 bits (231), Expect = 1.600e-22 Identity = 42/50 (84.00%), Postives = 49/50 (98.00%), Query Frame = 0 Query: 1 LVSRLRRHFLEGFQKPNDPMKVYYEHLAIVSMFRSGKLEPSIQALISNID 50 LVSRLRRHFLEGFQ+P+DPMK+YYEH+AIV+MFR+GKLE SIQAL+SNID Sbjct: 157 LVSRLRRHFLEGFQQPHDPMKIYYEHVAIVAMFRTGKLEVSIQALVSNID 206
BLAST of mRNA_M-pyrifera_M_contig78833.18520.1 vs. uniprot
Match: A0A517WXB9_9PLAN (Putative HTH-type transcriptional regulator YdfH n=2 Tax=Gimesia aquarii TaxID=2527964 RepID=A0A517WXB9_9PLAN) HSP 1 Score: 87.0 bits (214), Expect = 5.580e-20 Identity = 38/50 (76.00%), Postives = 46/50 (92.00%), Query Frame = 0 Query: 1 LVSRLRRHFLEGFQKPNDPMKVYYEHLAIVSMFRSGKLEPSIQALISNID 50 LVSRLRRHFLEGFQKP DPM++YYEH+AIV+MFRS KL+ ++Q LI+NID Sbjct: 157 LVSRLRRHFLEGFQKPGDPMRIYYEHVAIVAMFRSRKLDAAVQVLIANID 206
BLAST of mRNA_M-pyrifera_M_contig78833.18520.1 vs. uniprot
Match: A0A381W019_9ZZZZ (HTH gntR-type domain-containing protein n=1 Tax=marine metagenome TaxID=408172 RepID=A0A381W019_9ZZZZ) HSP 1 Score: 64.3 bits (155), Expect = 2.790e-11 Identity = 27/50 (54.00%), Postives = 39/50 (78.00%), Query Frame = 0 Query: 1 LVSRLRRHFLEGFQKPNDPMKVYYEHLAIVSMFRSGKLEPSIQALISNID 50 L+SR++ HF+ + K DPM++Y+EH AI SMFR+GKL+ +IQ L SNI+ Sbjct: 150 LISRVKGHFMRNYHKYRDPMEIYFEHEAIFSMFRTGKLDAAIQILESNIE 199 The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig78833.18520.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 of Macrocystis pyrifera male vs UniRef90) Total hits: 6
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_M-pyrifera_M_contig78833.18520.1 ID=prot_M-pyrifera_M_contig78833.18520.1|Name=mRNA_M-pyrifera_M_contig78833.18520.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=51bpback to top |