prot_M-pyrifera_M_contig78784.18511.1 (polypeptide) Macrocystis pyrifera P11B4 male
Overview
Homology
BLAST of mRNA_M-pyrifera_M_contig78784.18511.1 vs. uniprot
Match: A0A813A1V5_9DINO (Rnh1 protein (Fragment) n=1 Tax=Symbiodinium sp. KB8 TaxID=230985 RepID=A0A813A1V5_9DINO) HSP 1 Score: 63.9 bits (154), Expect = 2.820e-10 Identity = 33/67 (49.25%), Postives = 45/67 (67.16%), Query Frame = 0 Query: 5 EDAQLVQICVDGELGSGQCRALCAALLGRGVGMKDHGYAPLKSMRFWSSGLGDAGAGSIAQVLLGGP 71 E + Q+CVD +LG+ RAL AA+LG+G GMK H Y L+S+RFW + GDAG ++A +L GP Sbjct: 50 EAEHIQQVCVDSKLGALGTRALAAAVLGKGQGMKSH-YPFLRSLRFWEAETGDAGVAAVAALLKVGP 115 The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig78784.18511.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 of Macrocystis pyrifera male vs UniRef90) Total hits: 1
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_M-pyrifera_M_contig78784.18511.1 ID=prot_M-pyrifera_M_contig78784.18511.1|Name=mRNA_M-pyrifera_M_contig78784.18511.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=72bpback to top |