prot_M-pyrifera_M_contig785.18449.1 (polypeptide) Macrocystis pyrifera P11B4 male
Overview
Homology
BLAST of mRNA_M-pyrifera_M_contig785.18449.1 vs. uniprot
Match: A0A6H5JUA1_9PHAE (MFS domain-containing protein n=2 Tax=Ectocarpus TaxID=2879 RepID=A0A6H5JUA1_9PHAE) HSP 1 Score: 53.5 bits (127), Expect = 3.550e-7 Identity = 28/33 (84.85%), Postives = 29/33 (87.88%), Query Frame = 0 Query: 1 MEILVVAFVLEDVADTFGLNSVQKGLIGSASFF 33 MEILVVAFVLED+A TF L SV KGLIGSASFF Sbjct: 23 MEILVVAFVLEDIATTFELGSVGKGLIGSASFF 55
BLAST of mRNA_M-pyrifera_M_contig785.18449.1 vs. uniprot
Match: D7FV27_ECTSI (Major facilitator transporter n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D7FV27_ECTSI) HSP 1 Score: 47.8 bits (112), Expect = 3.900e-5 Identity = 23/33 (69.70%), Postives = 29/33 (87.88%), Query Frame = 0 Query: 1 MEILVVAFVLEDVADTFGLNSVQKGLIGSASFF 33 ME+LV+AF LE +A +F L+SV+KGLIGSASFF Sbjct: 1 MEVLVLAFALEAIATSFELSSVEKGLIGSASFF 33 The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig785.18449.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 of Macrocystis pyrifera male vs UniRef90) Total hits: 2
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_M-pyrifera_M_contig785.18449.1 ID=prot_M-pyrifera_M_contig785.18449.1|Name=mRNA_M-pyrifera_M_contig785.18449.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=38bpback to top |