prot_M-pyrifera_M_contig7848.18440.1 (polypeptide) Macrocystis pyrifera P11B4 male
Overview
Homology
BLAST of mRNA_M-pyrifera_M_contig7848.18440.1 vs. uniprot
Match: A0A6H5KZ75_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5KZ75_9PHAE) HSP 1 Score: 51.6 bits (122), Expect = 4.110e-5 Identity = 53/106 (50.00%), Postives = 68/106 (64.15%), Query Frame = 0 Query: 1 MDNIIQRFEKVLSFRESREET-------TALPKQPPLPQPEPVKDSRDRSVSARPMTVXXXXXXXXXXXXXXXSVASSLHFDDELSALGSAQSNTKHNENTERYRR 99 MDN++QR ++ E +A P+ PPLP P P ++R R VSAR +T+ XXXXXXXXXXXXSVAS LHFDDELSA S SN++H E+ +R +R Sbjct: 106 MDNVVQRLATYFPPDDTEGEPNTDVVPPSAAPELPPLPLPPP-DNARGRYVSARVLTMDRAXXXXXXXXXXXXSVASGLHFDDELSA--STASNSRHGEDEQRAKR 208 The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig7848.18440.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 of Macrocystis pyrifera male vs UniRef90) Total hits: 1
InterPro
Analysis Name: InterProScan on OGS1.0 of Macrocystis pyrifera male
Date Performed: 2022-09-29
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_M-pyrifera_M_contig7848.18440.1 ID=prot_M-pyrifera_M_contig7848.18440.1|Name=mRNA_M-pyrifera_M_contig7848.18440.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=123bpback to top |