prot_M-pyrifera_M_contig779.18320.1 (polypeptide) Macrocystis pyrifera P11B4 male
Overview
Homology
BLAST of mRNA_M-pyrifera_M_contig779.18320.1 vs. uniprot
Match: D7FUA9_ECTSI (CS domain-containing protein n=2 Tax=Ectocarpus TaxID=2879 RepID=D7FUA9_ECTSI) HSP 1 Score: 81.6 bits (200), Expect = 2.370e-16 Identity = 45/80 (56.25%), Postives = 55/80 (68.75%), Query Frame = 0 Query: 6 VNPDGTPEEMPDMDEMARSYDAEKFMFKDGDFSEEELSKYA---------ASVMSADGDGAPGSGIDIDDADVRAAFGLD 76 NPDGTP +MPDM+EMAR+Y+ E FMFK+GDFSEEELSKY + ++ D D PG ID+DD R+AFGLD Sbjct: 517 TNPDGTPAKMPDMEEMARAYETEGFMFKEGDFSEEELSKYMDMXXXXXXXXAGLALDDD-LPGGDIDLDDPATRSAFGLD 595 The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig779.18320.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 of Macrocystis pyrifera male vs UniRef90) Total hits: 1
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_M-pyrifera_M_contig779.18320.1 ID=prot_M-pyrifera_M_contig779.18320.1|Name=mRNA_M-pyrifera_M_contig779.18320.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=77bpback to top |